DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6927 and GABRB1

DIOPT Version :9

Sequence 1:NP_572194.1 Gene:CG6927 / 31419 FlyBaseID:FBgn0029733 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_000803.2 Gene:GABRB1 / 2560 HGNCID:4081 Length:474 Species:Homo sapiens


Alignment Length:488 Identity:123/488 - (25%)
Similarity:231/488 - (47%) Gaps:60/488 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 QLLDRLTHGCRYDRLERPITYSETGQRLPVDVYMRAYIYFMQNLEAHDLQFKIYALLQMRYLDPR 102
            :.:|||..|  ||...||    :.|.. ||||.||..:..:..:...::.:.:....|..:.|.|
Human    39 ETVDRLLKG--YDIRLRP----DFGGP-PVDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKR 96

  Fly   103 LNFRNVSPKRRQPILGEEHLRNSLWMPHIFLANERDSSILGLTEKDILTSISPDGTVIVSNRIKA 167
            |::..:...    :..:..:.:.||:|..:..|::.|.:.|:|.|:.:..:.|||||:...||..
Human    97 LSYSGIPLN----LTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITT 157

  Fly   168 TLYCWLNLKKFPFDEQHCSTVLESWMYNTSELVLHWE-QKRPITYDGALHLTEFVLQRSWSNETV 231
            |..|.::|:::|.|||:|:..:||:.|.|.::..:|. .:..:|....:.|.:|         ::
Human   158 TAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQF---------SI 213

  Fly   232 INADLSDLRHGAFAGNYSSLSFTVHLTRVVGFYLMDYFLPSMLIVAISWVSFWLQADQAPPRITL 296
            ::..:...:.....|.|..||.:..|.|.:|::::..::||.||..:||||||:..|.:..|:.|
Human   214 VDYKMVSKKVEFTTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVAL 278

  Fly   297 GTSTLLTFITLASAQGKTLPKVSYIKVSEVWFLGCTIFIFGSMVEFAFVNTIWRRKKSVPVKKLN 361
            |.:|:||..|:::...:||||:.|:|..:::.:||.:|:|.:::|:||||.|:..|.  |.||..
Human   279 GITTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKG--PQKKGA 341

  Fly   362 SKHIL----KSTLSPNLLRRRSHARSRSFSGTALHKTADTGSLGGAGFNNYLTVNLPITTIKEGQ 422
            ||...    |:.|..|.::..:|       |..|..|.:        ..|..:.:..:|::.:.:
Human   342 SKQDQSANEKNKLEMNKVQVDAH-------GNILLSTLE--------IRNETSGSEVLTSVSDPK 391

  Fly   423 VLDQQRTSRVVQKMDVNFVESAFGSMGSAQSTGAISAASSSQTLTNNNRTESAGHQEEIDLSGWT 487
            .......|..:|.........|:|            .|.....:.:..|......|.::.:...|
Human   392 ATMYSYDSASIQYRKPLSSREAYG------------RALDRHGVPSKGRIRRRASQLKVKIPDLT 444

  Fly   488 TLTPQEIAMWIDSRARFVFPLSFLVFNLFFWTF 520
            .:..      ||..:|..||::|.:||:.:|.:
Human   445 DVNS------IDKWSRMFFPITFSLFNVVYWLY 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6927NP_572194.1 LIC 3..520 CDD:273305 123/486 (25%)
Neur_chan_LBD 36..259 CDD:280998 55/221 (25%)
Neur_chan_memb 270..518 CDD:280999 65/251 (26%)
GABRB1NP_000803.2 LIC 9..472 CDD:273305 123/488 (25%)
Agonist binding. /evidence=ECO:0000250 120..122 0/1 (0%)
Agonist binding. /evidence=ECO:0000250 180..182 1/1 (100%)
Allosteric effector binding. /evidence=ECO:0000250 290..311 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.