DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6927 and ggr-3

DIOPT Version :9

Sequence 1:NP_572194.1 Gene:CG6927 / 31419 FlyBaseID:FBgn0029733 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_494951.3 Gene:ggr-3 / 191638 WormBaseID:WBGene00001588 Length:445 Species:Caenorhabditis elegans


Alignment Length:429 Identity:108/429 - (25%)
Similarity:181/429 - (42%) Gaps:85/429 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 YLDPRLNFRNVSPKRRQPILGEEHLRNSLWMPHIFLANERDSSILGLTEKDILTSISPDGTVIVS 162
            :.||||.:||:|.|....:  :.::...||.|::...|.:.:.:......:||..|.|:|||.::
 Worm    89 WYDPRLEYRNISCKTNLSL--DSYVSERLWTPNVCFVNSKSTQVHKSPASNILLIIYPNGTVWLN 151

  Fly   163 NRIKATLYCWLNLKKFPFDEQHCSTVLESWMYNTSELVLHWEQKRPITYDGA--LHLTEFVLQR- 224
            .|::.:..|...|.:||.|.|.|..|.||:.||.:|:.|:|:|..|:|....  ..|.:|.... 
 Worm   152 YRVQVSAPCSFELSRFPIDAQECHLVFESYSYNIAEVRLNWQQWAPVTMPPPEDFRLPDFQFYNV 216

  Fly   225 SW---SNETVINADLSDLRHGAFAGNYSSLSFTVHLTRVVGFYLMDYFLPSMLIVAISWVSFWLQ 286
            :|   |||..             ||.:..|..|....|:.|:|::..:||:.|.|.|||::||:.
 Worm   217 TWGKTSNEYT-------------AGMWDQLKVTFRFKRLYGYYVLQMYLPTYLSVFISWIAFWID 268

  Fly   287 ADQAPPRITLGTSTLLTFITLASAQGKTLPKVSYIKVSEVWFLGCTIFIFGSMVEFAFVNTIWRR 351
            ....|.|||||.|:|:..........|.||:||::|..::||..|..|||.|:||.|.|..:   
 Worm   269 TRALPARITLGVSSLMALTFQFGNIVKNLPRVSFVKAIDLWFFVCVAFIFFSLVELAVVGFV--- 330

  Fly   352 KKSVPVKKLNSKHILKSTLSPNLLRRRSHARSRSFSGTALHKTADTGSLGGAGFNNYLTVNLPIT 416
            .|...:|:.:.:...:..::...::.......|.:|.|:                          
 Worm   331 DKITEIKRRSRRIKFQRAIAGGTIKNDRPVSFRKYSCTS-------------------------- 369

  Fly   417 TIKEGQVLDQQRTSRVVQKMDVNFVESAFGSMGSAQSTGAISAASSSQTLTNNNRTESAGHQEEI 481
                       :.:.|...::.|..|..:...|.....|.        :..||:..|::.     
 Worm   370 -----------KCNSVRYNINNNDDEELYNISGETNGNGV--------SWKNNSSREASA----- 410

  Fly   482 DLSGWTTLTPQEIAMWIDSRARFVFPLSFLVFNLFFWTF 520
                       ::...:||.|...||..|..||:|:|.:
 Worm   411 -----------DMGARVDSFAAKAFPAMFAAFNVFYWWY 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6927NP_572194.1 LIC 3..520 CDD:273305 108/427 (25%)
Neur_chan_LBD 36..259 CDD:280998 48/166 (29%)
Neur_chan_memb 270..518 CDD:280999 56/247 (23%)
ggr-3NP_494951.3 LIC 39..439 CDD:273305 108/429 (25%)
Neur_chan_LBD 39..243 CDD:280998 49/168 (29%)
Neur_chan_memb 250..436 CDD:280999 56/249 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.