DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment boil and CG15482

DIOPT Version :9

Sequence 1:NP_572191.2 Gene:boil / 31416 FlyBaseID:FBgn0029730 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_609614.2 Gene:CG15482 / 34717 FlyBaseID:FBgn0032483 Length:309 Species:Drosophila melanogaster


Alignment Length:256 Identity:56/256 - (21%)
Similarity:101/256 - (39%) Gaps:43/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SHSRKIEATPMDVEEKDNNRDRKHILNHLSRAPGKCILSNCNQLVFPSNMLVHMLRKHNNSPNTN 74
            |.|||..||    ...|:...|..::        .|....|...|.||.:|.|.|..|.......
  Fly    84 SSSRKSTAT----TSSDSPWSRLRLV--------ACPCHGCLCSVDPSALLGHYLSDHLPGMGVP 136

  Fly    75 LAIIYDNQRLRKTFNLNSLKYDEPQVLNILLYAGTEGKPHTRPARRYLSYPNCGLPHSFGRYEHH 139
            ...:...:|:..|.:::||:.|...:|.:..|..|...|       ...:.|..||..:.|:..|
  Fly   137 FYELEMGKRVSLTCHISSLERDVNTLLGVYGYRRTGLNP-------LKCHRNTHLPVEYRRFSQH 194

  Fly   140 LMMNLMICKTSWFSMLPDRICGEKLEKMHGTPENTIYVIW----LMGPETSSRMFYTLTAYDRYY 200
            ..:.:..|:| ..|:|.:|    |..|      :.:..||    |.|...:.|:........|||
  Fly   195 SALMIFACRT-MHSVLWER----KRVK------HEVLAIWVATPLHGVAITLRLLVQPANLPRYY 248

  Fly   201 ---IQSRSVIRKTRNFFLSQQPKDFLNHENDYLMLRHEEAMDLMNGEGDELNQTSYIKLEL 258
               |::|.::..:.|    |...:|:..:::.:::...:...||  :.|...|:..::|::
  Fly   249 TRQIKARPMLPLSSN----QSCSEFIKTDSNVILISLNDLRPLM--DLDVWQQSLTVELKV 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
boilNP_572191.2 DUF4729 43..249 CDD:292491 46/212 (22%)
CG15482NP_609614.2 DUF4729 105..300 CDD:292491 47/226 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469471
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.