DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment boil and CG1314

DIOPT Version :9

Sequence 1:NP_572191.2 Gene:boil / 31416 FlyBaseID:FBgn0029730 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_608411.2 Gene:CG1314 / 33066 FlyBaseID:FBgn0031134 Length:378 Species:Drosophila melanogaster


Alignment Length:267 Identity:57/267 - (21%)
Similarity:90/267 - (33%) Gaps:81/267 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RIKKRSHSRKIEATP--------MDVEEKDNNRDRKHILNHLSRAPGKCILSNCNQLVFPSNMLV 61
            |:..|..:..|.|:|        :..|...|..........|.:....|.||||:.:..|..:|.
  Fly    95 RVPMRGGAEAISASPHGRISSPEIRYERLRNTAVEVRKYWRLQKLDMACPLSNCDLMFNPEQLLS 159

  Fly    62 HMLRKHNNSPNTNLAIIYDNQRLRKTFNLNSLKYDEPQVL-----------------NILLYAGT 109
            |.|..|.:       ||           ...:|..||:||                 .:::|  .
  Fly   160 HCLMHHEH-------II-----------TMEMKPKEPKVLKLCGKSLPEDRGKSNCVGLMIY--E 204

  Fly   110 EGKPHTRPARRYLSYPNCGLPHSFGRYEHHLMMNLMICKTSWFSMLPDRICGEKLEKMHGTPENT 174
            .|...||         |..||:.:..:|..|.:.:|:.||||.||            ..|.....
  Fly   205 SGNNATR---------NLNLPNIYKDWECQLPVLIMLWKTSWDSM------------PVGPRVTH 248

  Fly   175 IYVIWLMGPETSSRMFYTLTAYD-------RYYIQSRSVIRKTRNF-FLSQQP-------KDFLN 224
            ||::||..|:..:.:..::...:       |..||:.......:|. .||..|       ::...
  Fly   249 IYILWLCCPQAQTPLLVSVNIGENTPGVPRRQMIQTCQGSETLKNCDLLSDSPHFMRFTHREMKE 313

  Fly   225 HENDYLM 231
            |..||.:
  Fly   314 HTEDYTL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
boilNP_572191.2 DUF4729 43..249 CDD:292491 49/221 (22%)
CG1314NP_608411.2 DUF4729 142..319 CDD:292491 48/217 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469472
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.