DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment boil and CG15472

DIOPT Version :9

Sequence 1:NP_572191.2 Gene:boil / 31416 FlyBaseID:FBgn0029730 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_572184.1 Gene:CG15472 / 31409 FlyBaseID:FBgn0029724 Length:301 Species:Drosophila melanogaster


Alignment Length:299 Identity:64/299 - (21%)
Similarity:109/299 - (36%) Gaps:84/299 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RDRKHILNHLSRAPGKCILSNCNQLVFPSNMLVHMLRKH-NNSPNTNLAIIYDNQRLRKTFNLNS 92
            :..|..||||.:.|.:|.:..|...||..:||.|:.::| .::...:|.:.::.:|....|:::.
  Fly    19 KQTKLTLNHLCQLPAQCPIEKCISTVFKDDMLQHLAQRHFRSNVKKHLQVAFNGERCTLVFDVSQ 83

  Fly    93 LKYDEPQVLNILLYAGTEGKPHTRPARRYLSYPN-----CGLPHSFGRYEHHLMMNLMICKTSWF 152
            |...:...|.:|||.|..||....|..|...|.|     .||.    ..:.:|.:.:::.:|::.
  Fly    84 LIGTQTICLGVLLYGGVRGKHSQLPGEREFCYHNRLKEDSGLE----SLKDYLPIMVLVKRTTFL 144

  Fly   153 S-MLPDR--------------------------------------IC--GEKLEKMHGTPE---- 172
            . .|.||                                      .|  |:|...:..|.|    
  Fly   145 CWALVDRKMESQEDLNGKQSKDLKQVKHLDFSNDTHPKCSEESIKRCDSGQKNNDLKTTTEAEQE 209

  Fly   173 ----NTIYVIWLMGPETSSRMFYTLTAYDRYYIQSRSVIRKTRNFFLSQQ----------PKDFL 223
                :.|.:||.........:...:|.::......||.:|...|   |.|          |||  
  Fly   210 EIMDSDILIIWTQSAPCIRPLHVAMTVFNSTLSVGRSAMRCVAN---SGQMYTEIGGKDLPKD-- 269

  Fly   224 NHENDYLMLRHEEAMDLMNGEGDELNQTSYIKLELFLHE 262
            .|.   |::..:|..::...|       .::.|||.|||
  Fly   270 RHS---LLITQQELKEICGAE-------HHLHLELILHE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
boilNP_572191.2 DUF4729 43..249 CDD:292491 52/270 (19%)
CG15472NP_572184.1 DUF4729 33..284 CDD:292491 51/262 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469463
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009965
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.