DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6978 and YOL162W

DIOPT Version :9

Sequence 1:NP_572188.1 Gene:CG6978 / 31413 FlyBaseID:FBgn0029727 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_014480.1 Gene:YOL162W / 854002 SGDID:S000005522 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:94 Identity:20/94 - (21%)
Similarity:38/94 - (40%) Gaps:20/94 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 MLPTYMYRVL-NVNIRT-NGIISSLPYLAMWILAIVFGI---LADCLIRRNFS----------IT 355
            :|.||:..|| ::...| ...:.::|...:.|| ::||:   ...|..|...|          :.
Yeast    11 VLATYLTLVLRSIGFTTFQANLLAIPNFVLHIL-LLFGLTWSTEKCNNRLGLSLLQPLYTVPLLA 74

  Fly   356 VVR----KLMNSLGQYGPAVALISVGFVH 380
            |:|    .:.|..|.|.....::...::|
Yeast    75 VLRFWKGTMFNKWGTYAIITLILDNPYIH 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6978NP_572188.1 2A0114euk 38..478 CDD:129972 20/94 (21%)
MFS 45..473 CDD:119392 20/94 (21%)
YOL162WNP_014480.1 MFS <1..169 CDD:421695 20/94 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344240
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.