DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6978 and YOL163W

DIOPT Version :9

Sequence 1:NP_572188.1 Gene:CG6978 / 31413 FlyBaseID:FBgn0029727 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_014479.1 Gene:YOL163W / 854001 SGDID:S000005523 Length:169 Species:Saccharomyces cerevisiae


Alignment Length:151 Identity:28/151 - (18%)
Similarity:57/151 - (37%) Gaps:18/151 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LGWGMMINSLAAFFIPISARSGGVVGLCVVRFIQGLGEGPIVPCSHSLLAQWVPPNERSLAGAAV 193
            :.|.::..        :..:..|.......|.:.||.||..|......::.:...:|.|:..:..
Yeast     2 IAWSLVAT--------LQCKMTGKSSFYTCRALMGLFEGGFVADLVLWMSYFYSSSELSIRLSFF 58

  Fly   194 YAGAQFGTIV-SMPLSGLLAHYGFDG--GWPSIFYIFGLFSTI-----WCIIFICLVQESPAVST 250
            :.......|: |:...|:....|..|  ||..:|.|..:|:.:     :.::...:||.....|.
Yeast    59 WVTLSLTQIITSIVAFGVFHMRGIGGMAGWQWLFLIERIFTLVIGISAYFLMVPSVVQTKKPWSK 123

  Fly   251 R--ISEAERRHIMEAIWQAQP 269
            :  .:|.|.:.|:..|.:..|
Yeast   124 KGWFTEREEKIIVNKILRDDP 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6978NP_572188.1 2A0114euk 38..478 CDD:129972 28/151 (19%)
MFS 45..473 CDD:119392 28/151 (19%)
YOL163WNP_014479.1 MFS 1..>151 CDD:421695 28/151 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344241
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.