DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6978 and SEO1

DIOPT Version :9

Sequence 1:NP_572188.1 Gene:CG6978 / 31413 FlyBaseID:FBgn0029727 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_009333.1 Gene:SEO1 / 851230 SGDID:S000000062 Length:593 Species:Saccharomyces cerevisiae


Alignment Length:408 Identity:79/408 - (19%)
Similarity:140/408 - (34%) Gaps:110/408 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 VVLMLFSGMA------------NAYV--MRTNMSVAIVAMVNHTAISHTKSSTQSKERDGDFEWS 94
            |:|..:|.:|            ||||  |:.::......:| ||.:.:|                
Yeast   137 VLLAFYSCIAYWVKYLDTVNINNAYVSGMKEDLGFQGNDLV-HTQVMYT---------------- 184

  Fly    95 YKLQGYILSSFFYGYVITQIPF-----GLMIKYYGARHFLGWGMMINSLAAFFIPISARSGGVVG 154
                        .|.:|.|:||     .|.:.|......|.|.::  ::.|.::      ..|..
Yeast   185 ------------VGNIIFQLPFLIYLNKLPLNYVLPSLDLCWSLL--TVGAAYV------NSVPH 229

  Fly   155 LCVVRFIQGLGEGPIVPCSHSLLAQWVPPNERSLAGAAVYAGAQFGT-----IVSMPLSGLLAHY 214
            |..:||..|..|.|.......|...:...:|.....|..|.|...|.     |.|...|.|....
Yeast   230 LKAIRFFIGAFEAPSYLAYQYLFGSFYKHDEMVRRSAFYYLGQYIGILSAGGIQSAVYSSLNGVN 294

  Fly   215 GFDGGWPSIFYIFGLFSTIWCIIFICLVQESP--AVSTRISEAERRHIMEAIWQAQPEERSRIPF 277
            |.: ||...|.|..:.|.:..:|....:...|  ..|..:::.|.|...:.:.:.|..:..    
Yeast   295 GLE-GWRWNFIIDAIVSVVVGLIGFYSLPGDPYNCYSIFLTDDEIRLARKRLKENQTGKSD---- 354

  Fly   278 LGIAKSPPFYAILVAHAGHNYGYETLMTMLPTYMYRVLNVNIRTNGIISSLPYLAMWI------- 335
               .::..|...|         ::|:.:....|:..:.|:....:..:||..|| :|:       
Yeast   355 ---FETKVFDIKL---------WKTIFSDWKIYILTLWNIFCWNDSNVSSGAYL-LWLKSLKRYS 406

  Fly   336 -------------LAIVF----GILADCLIRRNFSITVVRKLMNSLGQYGPAVALISVGFVHHSL 383
                         |.:|:    ||:||.|..|.|:| :..::.|.:|....|...::.|    :.
Yeast   407 IPKLNQLSMITPGLGMVYLMLTGIIADKLHSRWFAI-IFTQVFNIIGNSILAAWDVAEG----AK 466

  Fly   384 WLTSVIFILGMGLNGAIY 401
            |...::...|..:...:|
Yeast   467 WFAFMLQCFGWAMAPVLY 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6978NP_572188.1 2A0114euk 38..478 CDD:129972 79/408 (19%)
MFS 45..473 CDD:119392 78/407 (19%)
SEO1NP_009333.1 MFS_FEN2_like 134..548 CDD:340885 79/408 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.