DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6978 and SLC37A3

DIOPT Version :9

Sequence 1:NP_572188.1 Gene:CG6978 / 31413 FlyBaseID:FBgn0029727 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_996996.1 Gene:SLC37A3 / 84255 HGNCID:20651 Length:494 Species:Homo sapiens


Alignment Length:483 Identity:93/483 - (19%)
Similarity:155/483 - (32%) Gaps:135/483 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 SHTKSSTQSKERDGDFEWSYKLQGYILSS--------------------FFYGYVITQIPFGLMI 120
            |:.|.|...:.....|..|.:|...|.||                    |.:.|.:.....|::.
Human    42 SNVKVSISEQWTPSAFNTSVELPVEIWSSNHLFPSAEKATLFLGTLDTIFLFSYAVGLFISGIVG 106

  Fly   121 KYYGARHFLGWGMMINSLAAFFIPISARSGGVVG-------------LCVVRFIQGLGEGPIVPC 172
            .....|..|.:||..::|..|          |.|             .|.:..:.||.:....||
Human   107 DRLNLRWVLSFGMCSSALVVF----------VFGALTEWLRFYNKWLYCCLWIVNGLLQSTGWPC 161

  Fly   173 SHSLLAQWVPPNERSLAGAAVYAGAQFGTIVSMPLSGLLAHYGFDGGWPSIFYIFGLFSTI---- 233
            ..:::..|.....|.:......|.|..|.|:...|:..:..||::       |.|.:.:::    
Human   162 VVAVMGNWFGKAGRGVVFGLWSACASVGNILGACLASSVLQYGYE-------YAFLVTASVQFAG 219

  Fly   234 WCIIFICLVQESPAVSTRISEAERRHIMEAIWQAQPEERSRIPFLGIAKS----PPFYAI----L 290
            ..:||..|:.....:.....|||...          ||.|..|.:...::    .|.|:|    .
Human   220 GIVIFFGLLVSPEEIGLSGIEAEENF----------EEDSHRPLINGGENEDEYEPNYSIQDDSS 274

  Fly   291 VAHAGHNYGYET--LMTMLPTYMYRVLNVNIRTNGIISSLPY---------------LAMW---- 334
            ||.......|:.  |..::| |......:.:........||:               |::|    
Human   275 VAQVKAISFYQACCLPGVIP-YSLAYACLKLVNYSFFFWLPFYLSNNFGWKEAEADKLSIWYDVG 338

  Fly   335 --ILAIVFGILADCLIRRNFSITVVRKLMNSLGQYGPAVA---LISVGFV-----------HHSL 383
              |...:.|.::|.|.:|                 .|.:|   |::||.:           .::|
Human   339 GIIGGTLQGFISDVLQKR-----------------APVLALSLLLAVGSLIGYSRSPNDKSINAL 386

  Fly   384 WLTSVIFILGMGLNGAIYCGFK--INHLDLSPRFAGLLISVTNCVANLVGLMAPMVAGHVIDPKP 446
            .:|...|.:| |.:..|.....  :...:|..|.:..|.:||..|.. .|.:...|..:::....
Human   387 LMTVTGFFIG-GPSNMISSAISADLGRQELIQRSSEALATVTGIVDG-SGSIGAAVGQYLVSLIR 449

  Fly   447 SVENWRIVFYIAAGVFIFTASFYNVFAS 474
            ....|..|||.    ||...|...||.|
Human   450 DKLGWMWVFYF----FILMTSCTIVFIS 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6978NP_572188.1 2A0114euk 38..478 CDD:129972 93/483 (19%)
MFS 45..473 CDD:119392 91/480 (19%)
SLC37A3NP_996996.1 UhpC 14..479 CDD:332119 93/483 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148735
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.