DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6978 and slc17a9a

DIOPT Version :9

Sequence 1:NP_572188.1 Gene:CG6978 / 31413 FlyBaseID:FBgn0029727 Length:479 Species:Drosophila melanogaster
Sequence 2:XP_001336574.1 Gene:slc17a9a / 799506 ZFINID:ZDB-GENE-081021-1 Length:458 Species:Danio rerio


Alignment Length:405 Identity:111/405 - (27%)
Similarity:185/405 - (45%) Gaps:71/405 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 DFEWSYKLQGYILSSFFYGYVITQIPFGLMIKYYGARHFL-----GWGMMINSLAAFFIPISARS 149
            :||||....|.:|.:||:||..||:..|......|....|     .||:|     ....||.|::
Zfish    77 EFEWSKTETGMVLGAFFWGYCFTQVVGGHASDRIGGERVLLLSTSSWGIM-----TALTPILAKT 136

  Fly   150 G--GVVGLCVVRFIQGLGEGPIVPCSHSLLAQWVPPNERSLAGAAVYAGAQFGTIVSMPLSGLLA 212
            |  .::.:...||:.|:.:|...|...|:.:|.|...||.|..:.:..|...|.::...:..|:.
Zfish   137 GLSPLLTMTASRFLLGVMQGVHYPSLVSICSQRVTEGERGLLMSTLACGCYLGMMLVGGVGSLML 201

  Fly   213 HYGFDGGWPSIFYIFGLFSTIW-CIIFICLVQESPAVSTRISEAERRHIMEAIWQAQPE--ERSR 274
            .:   .||.|:||..||.:..| |.::.||:|     .|.||       ::::|.::.:  |.||
Zfish   202 DW---FGWQSVFYGAGLLAVFWACCVWKCLLQ-----GTDIS-------LDSLWISRKDVSESSR 251

  Fly   275 IPFLGIAKSPPFYAILVAHAGHNYGYETLMTMLPTYMYRVLNVNIRTNGIISSLPYLAMWILAIV 339
            |.:|.:.:.|..:|:::||...:..|.|||:.|||:..             .:.|:...|:..::
Zfish   252 INWLYLLREPSVWAMIIAHLCFSSSYYTLMSWLPTFFK-------------DTFPHAKDWVFNVI 303

  Fly   340 -----------FGILADCLIRRNFSITVVRKLMN--SLGQYGPAVALISVGFV-HHSLWLTSVIF 390
                       .|.::|.|||:......|||||.  |:|     ||.:.:.|: ..|.::.:|..
Zfish   304 PWFVALPTSLFGGSISDHLIRQGCGTAAVRKLMQFCSMG-----VASVFILFLCKTSSFIQAVAC 363

  Fly   391 I-LGMGLNGAIYCGFKINHLDLSPRFAGLLISVTNCVANLVGLMAPMVAGHVIDPKPSVENWRIV 454
            : :.:||:.....|..:|..|.:|..||.|..|.|..|...||:...::|::|:...|   |..|
Zfish   364 VSVTIGLSTFHNSGVSVNVNDQAPSCAGALYGVMNTCAAFTGLLMVYISGYMIEVTGS---WVNV 425

  Fly   455 FYIAA-----GVFIF 464
            |.:.|     ||.:|
Zfish   426 FSVLALVNVIGVAVF 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6978NP_572188.1 2A0114euk 38..478 CDD:129972 111/405 (27%)
MFS 45..473 CDD:119392 111/405 (27%)
slc17a9aXP_001336574.1 MFS 50..443 CDD:119392 111/405 (27%)
MFS_1 53..407 CDD:284993 100/367 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.