DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6978 and CG7091

DIOPT Version :9

Sequence 1:NP_572188.1 Gene:CG6978 / 31413 FlyBaseID:FBgn0029727 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_650243.2 Gene:CG7091 / 41590 FlyBaseID:FBgn0038099 Length:509 Species:Drosophila melanogaster


Alignment Length:417 Identity:102/417 - (24%)
Similarity:178/417 - (42%) Gaps:43/417 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 TQSKERDGDFEWSYKLQGYILSSFFYGYVITQIPFGLMIKYYGARHFLGWGMMINSLAAFFIPIS 146
            |||    ||..|:...:......::||||::....|.:.....::......::..::|...:|..
  Fly    98 TQS----GDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKRLFIVSLIFEAVAYILLPAM 158

  Fly   147 ARS---GGVVGLCVVRFIQGLGEGPIVPCSHSLLAQWVPPNERSLAGAAVYAGAQFGTIVSMPLS 208
            |.|   .|||.|.:...:.|.|.    |..:.|...|..|.||:...:..|:|...|:::..|::
  Fly   159 AHSSFEAGVVDLVICGLLAGCGN----PAMYKLFVTWAHPTERTALLSFAYSGLLMGSMLVYPVA 219

  Fly   209 GLLAHYGFDGGWPSIFYIFG----LFSTIWCIIFICLVQESPAVSTRISEAERRHIMEAIWQAQP 269
            ..|:::    ||...||:.|    .|....|.:....|::.|.:|....:..|:...:...|.||
  Fly   220 SYLSNF----GWELSFYVVGGVGLSFGIACCFLVYDTVEQHPRISNEEVDYLRQGKSQLGQQRQP 280

  Fly   270 EERSRIPFLGIAKSPPFYAILVAHAGHNYGYETLMTMLPTYMYRVLNVNIRTNGIISSLPYLAMW 334
            .  ..||:..:..:||.||.::.|..|.|.:..::.::|.:|...:..::|..|.:|:.|||. .
  Fly   281 V--VTIPWKSLLAAPPVYAFILTHMFHTYTFLVIVQLMPRFMREAMEFDLREVGFLSAAPYLG-G 342

  Fly   335 ILAIVFGILADCLIRRNF--SITVVRKLMNSLGQYG----PAVALISVGFVHH--SLWLTSVIFI 391
            |.:.|..||....:.|..  ....||:::     ||    ...:||.|..:.:  ...|..|:|.
  Fly   343 ICSKVMCILGGSYVERRVGPDQNCVRRML-----YGICSILTTSLIGVIILANCDDKILVLVMFA 402

  Fly   392 LGMGLNGAIYCGFKINHLDLSPRFAGLLISVTNCVANLVGLMAPMVAGHVIDPKPSVENWRIVFY 456
            ..|......:.|:....|..:|.|||||..:.|.:|:|.|.:||.:...::. ..|.:.|.:|..
  Fly   403 FMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGMAHLSGFLAPHLVAALVH-TGSKDEWNVVLM 466

  Fly   457 IAAGVFIFTASFYNVFA----SGKQQW 479
            .   :.:|......|||    :..|.|
  Fly   467 T---LIVFNTMAMLVFAFCSSTNLQPW 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6978NP_572188.1 2A0114euk 38..478 CDD:129972 100/414 (24%)
MFS 45..473 CDD:119392 98/405 (24%)
CG7091NP_650243.2 2A0114euk 77..498 CDD:129972 102/417 (24%)
MFS 115..482 CDD:119392 94/386 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 1 1.000 - - mtm14983
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.