DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6978 and Slc17a9

DIOPT Version :9

Sequence 1:NP_572188.1 Gene:CG6978 / 31413 FlyBaseID:FBgn0029727 Length:479 Species:Drosophila melanogaster
Sequence 2:XP_038961483.1 Gene:Slc17a9 / 362287 RGDID:1311940 Length:448 Species:Rattus norvegicus


Alignment Length:393 Identity:103/393 - (26%)
Similarity:159/393 - (40%) Gaps:78/393 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MLFSGMANAYVMRTNMSVAIVAMVNHTAISHTKSSTQSKERDGDFEWSYKLQGYILSSFFYGYVI 111
            ||..|....|..|..|.|..|||                  ..||.|:.|..|.:|||||:||.:
  Rat    40 MLLLGTCLLYCTRVTMPVCTVAM------------------SQDFGWNKKEAGIVLSSFFWGYCL 86

  Fly   112 TQIPFGLMIKYYGARHFL-----GWGMMINSLAAFFIPISAR--SGGVVGLCVVRFIQGLGEGPI 169
            ||:..|.:....|....:     .||.:     ....|:.|.  ||.:..:...|.:.||.:|..
  Rat    87 TQVVGGHLGDRIGGEKVILLSASAWGFI-----TVTTPLLAHLGSGHLAFVTFSRILTGLLQGVY 146

  Fly   170 VPCSHSLLAQWVPPNERSLAGAAVYAGAQFGTIVSMPLSGLLAHYGFDG-GWPSIFYIFGLFSTI 233
            .|...|||:|.|..:|||...:.|.||:|.||:|:..:..:|    .|. ||.|:||..|..:.:
  Rat   147 FPALTSLLSQRVQESERSFTYSTVGAGSQVGTLVTGGIGSVL----LDRCGWQSVFYFSGGLTLL 207

  Fly   234 WC-IIFICLVQESPAVSTRISEAERRHIMEAIWQAQPEER-SRIPFLGIAKSPPFYAILVAHAGH 296
            |. .::..|:.|...|..          :..:.|..|..| |::|:..:.:....:|::.:....
  Rat   208 WVYYVYKYLLDEKDLVLA----------LGVLAQGLPVTRPSKVPWRQLFRKASVWAVICSQLSS 262

  Fly   297 NYGYETLMTMLPTYMYRVLNVNIRTNG-IISSLPYLAMWILAI---VF-GILADCLIRRNFSITV 356
            ...:..|::.|||:......   .:.| :.:.:|    |:|||   :| |.::|.||.:.:.:..
  Rat   263 ACSFFILLSWLPTFFKETFP---HSKGWVFNVVP----WLLAIPASLFSGFISDRLISQGYRVIT 320

  Fly   357 VRKLMNSL-GQYGP--AVALISVGFVHHSL-----------WLTSV----IFILGMGLNGAIYCG 403
            |||.|... ..:||  ......|...||.|           ||..:    .|....| .|.|.|.
  Rat   321 VRKFMQPCPAGHGPWSVKHFCPVSGSHHKLPQVYDLCVSVHWLPDLQPQWYFSQHSG-PGPILCW 384

  Fly   404 FKI 406
            |.:
  Rat   385 FPV 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6978NP_572188.1 2A0114euk 38..478 CDD:129972 103/393 (26%)
MFS 45..473 CDD:119392 103/393 (26%)
Slc17a9XP_038961483.1 MFS 38..>326 CDD:421695 88/329 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.