powered by:
Protein Alignment CG6978 and ZK54.3
DIOPT Version :9
Sequence 1: | NP_572188.1 |
Gene: | CG6978 / 31413 |
FlyBaseID: | FBgn0029727 |
Length: | 479 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001379785.1 |
Gene: | ZK54.3 / 266895 |
WormBaseID: | WBGene00022648 |
Length: | 89 |
Species: | Caenorhabditis elegans |
Alignment Length: | 41 |
Identity: | 9/41 - (21%) |
Similarity: | 20/41 - (48%) |
Gaps: | 2/41 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 KTRFFVVLMLFSGMANAYVMRTNMSVAIVAMVNHTAISHTK 79
|.|..|.::...|. |::..|.::::...|.:...::.||
Worm 26 KRRHLVAVLAMFGF--AFIYGTQITLSNTFMEDEQKVNKTK 64
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG6978 | NP_572188.1 |
2A0114euk |
38..478 |
CDD:129972 |
9/41 (22%) |
MFS |
45..473 |
CDD:119392 |
6/35 (17%) |
ZK54.3 | NP_001379785.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000034 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.