DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6978 and Slc17a8

DIOPT Version :9

Sequence 1:NP_572188.1 Gene:CG6978 / 31413 FlyBaseID:FBgn0029727 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_714947.1 Gene:Slc17a8 / 266767 RGDID:628870 Length:588 Species:Rattus norvegicus


Alignment Length:495 Identity:168/495 - (33%)
Similarity:250/495 - (50%) Gaps:32/495 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VYDSKGVSNR-----NRSDQEVRMERYASDGQIPRCR-----------KTRFFVVLMLFSGMANA 55
            |.||.|:..|     |.....:.:.......|..|.|           ..|:.:.:|...|...:
  Rat    25 VGDSLGILQRKLDGTNEEGDAIELSEEGRPVQTSRARAPVCDCSCCGIPKRYIIAVMSGLGFCIS 89

  Fly    56 YVMRTNMSVAIVAMVNH-TAISHTKSSTQSKERDGDFEWSYKLQGYILSSFFYGYVITQIPFGLM 119
            :.:|.|:.||||.|||: |.....|...|:.:    |.|..:..|.|..|||:||::||||.|.:
  Rat    90 FGIRCNLGVAIVEMVNNSTVYVDGKPEIQTAQ----FNWDPETVGLIHGSFFWGYIVTQIPGGFI 150

  Fly   120 IKYYGARHFLGWGMMINSLAAFFIPISARSGGVVGLCVVRFIQGLGEGPIVPCSHSLLAQWVPPN 184
            ...:.|....|..:.:.|....|||.:||......:| ||.:|||.||...|..|.:.::|.||.
  Rat   151 SNKFAANRVFGAAIFLTSTLNMFIPSAARVHYGCVMC-VRILQGLVEGVTYPACHGMWSKWAPPL 214

  Fly   185 ERSLAGAAVYAGAQFGTIVSMPLSGLLAHYGFDGGWPSIFYIFGLFSTIWCIIFICLVQESPAVS 249
            |||......:.|:..|.:|:|||:|:|..|   .||.|:|||:|:|..||.:.::....|.|||.
  Rat   215 ERSRLATTSFCGSYAGAVVAMPLAGVLVQY---IGWASVFYIYGMFGIIWYMFWLLQAYECPAVH 276

  Fly   250 TRISEAERRHIMEAIWQ-AQPEERSRI--PFLGIAKSPPFYAILVAHAGHNYGYETLMTMLPTYM 311
            ..||..||.:|..:|.: |.....|:.  |:.....|.|.|||:||:...::.:..|:...|.|.
  Rat   277 PTISNEERTYIETSIGEGANLASLSKFNTPWRRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYF 341

  Fly   312 YRVLNVNIRTNGIISSLPYLAMWILAIVFGILADCL-IRRNFSITVVRKLMNSLGQYGPAVALIS 375
            ..|....|...|::|::|::.|.|:..:.|.|||.| .|:..:.|.|||:||..|....|..|:.
  Rat   342 EEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRKILTTTAVRKIMNCGGFGMEATLLLV 406

  Fly   376 VGFVHHSLWLTSVIFILGMGLNGAIYCGFKINHLDLSPRFAGLLISVTNCVANLVGLMAPMVAGH 440
            ||| .|:..:.....:|.:|.:|....||.:||||::||:|.:|:.::|.|..|.|::.|::.|.
  Rat   407 VGF-SHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGA 470

  Fly   441 VIDPKPSVENWRIVFYIAAGVFIFTASFYNVFASG-KQQW 479
            :...| :.|.|:.||.|||.|......||.||||| ||.|
  Rat   471 MTKHK-TREEWQNVFLIAALVHYSGVIFYGVFASGEKQDW 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6978NP_572188.1 2A0114euk 38..478 CDD:129972 158/456 (35%)
MFS 45..473 CDD:119392 151/432 (35%)
Slc17a8NP_714947.1 MFS_SLC17A6_7_8_VGluT 79..502 CDD:340940 151/432 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 539..588
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342514
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100421
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.