DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6978 and SLC17A5

DIOPT Version :9

Sequence 1:NP_572188.1 Gene:CG6978 / 31413 FlyBaseID:FBgn0029727 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001369562.1 Gene:SLC17A5 / 26503 HGNCID:10933 Length:533 Species:Homo sapiens


Alignment Length:432 Identity:162/432 - (37%)
Similarity:251/432 - (58%) Gaps:22/432 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PRCRKTRFFVVLMLFSGMANAYVMRTNMSVAIVAMV-NHTAISHTKSSTQSKERDG--------- 89
            |.|...|:.:.::.|.|....|.:|.|:|||:|.|| ::|.:...::|....|...         
Human    33 PVCCSARYNLAILAFFGFFIVYALRVNLSVALVDMVDSNTTLEDNRTSKACPEHSAPIKVHHNQT 97

  Fly    90 --DFEWSYKLQGYILSSFFYGYVITQIPFGLMIKYYGARHFLGWGMMINSLAAFFIPISARSGGV 152
              .::|..:.||:||.||||||:|||||.|.:....|.:..||:|::..::...|.||:|..|  
Human    98 GKKYQWDAETQGWILGSFFYGYIITQIPGGYVASKIGGKMLLGFGILGTAVLTLFTPIAADLG-- 160

  Fly   153 VG-LCVVRFIQGLGEGPIVPCSHSLLAQWVPPNERSLAGAAVYAGAQFGTIVSMPLSGLLAHYGF 216
            || |.|:|.::|||||...|..|::.:.|.||.|||...:..|||||.||::|:||||::.:|  
Human   161 VGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLSISYAGAQLGTVISLPLSGIICYY-- 223

  Fly   217 DGGWPSIFYIFGLFSTIWCIIFICLVQESPAVSTRISEAERRHIMEAIWQAQPEERSRIPFLGIA 281
             ..|..:||.||.....|.:::|.||.::|....|||..|:.:|:.:: :.|...:..:|::.|.
Human   224 -MNWTYVFYFFGTIGIFWFLLWIWLVSDTPQKHKRISHYEKEYILSSL-RNQLSSQKSVPWVPIL 286

  Fly   282 KSPPFYAILVAHAGHNYGYETLMTMLPTYMYRVLNVNIRTNGIISSLPYLAMWILAIVFGILADC 346
            ||.|.:||:|||..:|:.:.||:|:|||||..:|..|::.||.:||||||..|:..|:.|..||.
Human   287 KSLPLWAIVVAHFSYNWTFYTLLTLLPTYMKEILRFNVQENGFLSSLPYLGSWLCMILSGQAADN 351

  Fly   347 L-IRRNFSITVVRKLMNSLGQYGPAVALISVGFVHHSLWLTSVIFILGMGLNGAIYCGFKINHLD 410
            | .:.|||...||::.:.:|..||||.|::.||:.....|......:...|.|....||.|||||
Human   352 LRAKWNFSTLCVRRIFSLIGMIGPAVFLVAAGFIGCDYSLAVAFLTISTTLGGFCSSGFSINHLD 416

  Fly   411 LSPRFAGLLISVTNCVANLVGLMAPMVAGHVIDPKPSVENWR 452
            ::|.:||:|:.:||..|.:.|::.|::| ..:.|...|: ||
Human   417 IAPSYAGILLGITNTFATIPGMVGPVIA-KSLTPDAGVQ-WR 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6978NP_572188.1 2A0114euk 38..478 CDD:129972 160/429 (37%)
MFS 45..473 CDD:119392 159/422 (38%)
SLC17A5NP_001369562.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Dileucine internalization motif 22..23
MFS_SLC17A5 42..458 CDD:340939 159/423 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148601
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D378598at33208
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100421
Panther 1 1.100 - - O PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.