DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6978 and SLC37A2

DIOPT Version :9

Sequence 1:NP_572188.1 Gene:CG6978 / 31413 FlyBaseID:FBgn0029727 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_938018.1 Gene:SLC37A2 / 219855 HGNCID:20644 Length:505 Species:Homo sapiens


Alignment Length:501 Identity:105/501 - (20%)
Similarity:184/501 - (36%) Gaps:131/501 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RFFVVLMLFSGMANAYVMRTNMSVAIVAMVNHTAISHTKSSTQSKERD-----GDFEW------- 93
            |..::|:.|...|..::.|..:|:....:       |...|.|.|..:     .|..|       
Human    22 RGLILLLTFLIYACYHMSRKPISIVKSRL-------HQNCSEQIKPINDTHSLNDTMWCSWAPFD 79

  Fly    94 --SYK-LQGYILSSFFYGYVITQIPFGLMIKYYGARHFLGWGMMINSLAA--------------- 140
              :|| |.|.:.::|...|.|.....|:..:....|::|..||:::.|..               
Human    80 KDNYKELLGGVDNAFLIAYAIGMFISGVFGERLPLRYYLSAGMLLSGLFTSLFGLGYFWNIHELW 144

  Fly   141 FFIPISARSGGVVGLCVVRFIQGLGEGPIVPCSHSLLAQWVPPNERSLAGAAVYAGAQFGTIVSM 205
            :|:.|...:|         .:|..|...:|.|    :..|....:|........:....|.|   
Human   145 YFVVIQVCNG---------LVQTTGWPSVVTC----VGNWFGKGKRGFIMGIWNSHTSVGNI--- 193

  Fly   206 PLSGLLAHYGFDGGWPSIFYIFGLFSTIWCII-FICLV--------------------QESPAVS 249
             |..|:|....:|.|...|.:.|:.:.:..:| |:.|:                    |::|...
Human   194 -LGSLIAGIWVNGQWGLSFIVPGIITAVMGVITFLFLIEHPEDVDCAPPQHHGEPAENQDNPEDP 257

  Fly   250 TRISEAERRHIMEAIWQAQP---EERSRIPFLGIAKSPP--------FYAILVAHAGHNYGYETL 303
            .....:.|...:|.:.:...   ||.:.|.|.|..:.|.        .:|.||::        |.
Human   258 GNSPCSIRESGLETVAKCSKGPCEEPAAISFFGALRIPGVVEFSLCLLFAKLVSY--------TF 314

  Fly   304 MTMLPTYMYRVLNVNIRTNGIISSLPYLAMWILAIVFGILADCLIRRNFSITV-------VRKLM 361
            :..||.|:..|.:.:.:..|.:|:|..:...|..||.|:::|....|..:..|       :..|.
Human   315 LYWLPLYIANVAHFSAKEAGDLSTLFDVGGIIGGIVAGLVSDYTNGRATTCCVMLILAAPMMFLY 379

  Fly   362 NSLGQYGPAVALISV----GFVH--HSLWLTSVIFILGMGLNGAIYCGFKINHLDLSPRFAGLLI 420
            |.:||.|.|.:::.:    |.|:  ::|..|:|...||             .|..|... |..|.
Human   380 NYIGQDGIASSIVMLIICGGLVNGPYALITTAVSADLG-------------THKSLKGN-AKALS 430

  Fly   421 SVTNCV---ANLVGLMAPMVAGHVIDPKPSVENWRIVFY--IAAGV 461
            :||..:   .::...:.|::|| :|.|    ..|..|||  |:|.|
Human   431 TVTAIIDGTGSIGAALGPLLAG-LISP----TGWNNVFYMLISADV 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6978NP_572188.1 2A0114euk 38..478 CDD:129972 105/501 (21%)
MFS 45..473 CDD:119392 104/497 (21%)
SLC37A2NP_938018.1 UhpC 25..478 CDD:332119 104/498 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..262 2/21 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148737
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.