DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6978 and Slc17a1

DIOPT Version :9

Sequence 1:NP_572188.1 Gene:CG6978 / 31413 FlyBaseID:FBgn0029727 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_598238.2 Gene:Slc17a1 / 171080 RGDID:620099 Length:465 Species:Rattus norvegicus


Alignment Length:467 Identity:138/467 - (29%)
Similarity:240/467 - (51%) Gaps:23/467 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 MERYASDGQIPRCRKTRFFVVLMLFSGMANAYVM--RTNMSVAIVAMVNHTAISHTKSSTQSKER 87
            ||......::|.....|:.:.::|.  ..|..:|  |..:::.:|||||.|...|..:.:.::..
  Rat     1 MENRCLPKKVPGFCSFRYGLAILLH--FCNIVIMAQRVCLNLTMVAMVNKTEPPHLSNKSVAEML 63

  Fly    88 DG----DFEWSYKLQGYILSSFFYGYVITQIPFGLMIKYYGARHFLGWGMMINSLAAFFIPISAR 148
            |.    ...||..:||.||||.|.|.|:.|:|.|.:...|..:..:|..:.::|:.:..||.:|:
  Rat    64 DNVKNPVHSWSLDIQGLILSSVFLGMVVIQVPVGYLSGAYPMKKIIGSSLFLSSVLSLLIPPAAQ 128

  Fly   149 SGGVVGLCVVRFIQGLGEGPIVPCSHSLLAQWVPPNERSLAGAAVYAGAQFGTIVSMPLSGLLAH 213
            .|..: :.|.|.:||:.:|.:....|.:..:|.||.||....:...:|...|..:::.:||.:..
  Rat   129 VGAAL-VIVCRVLQGIAQGAVSTGQHGIWVKWAPPLERGRLTSMTLSGFVMGPFIALLVSGFICD 192

  Fly   214 YGFDGGWPSIFYIFGL----FSTIWCIIFICLVQESPAVSTRISEAERRHIMEAIWQAQPEERSR 274
            .   .|||.:|||||:    .|..|.|:|.    :.|.....:|.:|:.:|..::.|.....|..
  Rat   193 L---LGWPMVFYIFGIVGCVLSLFWFILFF----DDPNNHPYMSSSEKDYITSSLMQQVHSGRQS 250

  Fly   275 IPFLGIAKSPPFYAILVAHAGHNYGYETLMTMLPTYMYRVLNVNIRTNGIISSLPYLAMWILAIV 339
            :|...:.||.|.:||::......:....|:|..||::...|:||:|.||::||||||..:|..||
  Rat   251 LPIKAMLKSLPLWAIILNSFAFIWSNNLLVTYTPTFISTTLHVNVRENGLLSSLPYLLAYICGIV 315

  Fly   340 FGILADCLI-RRNFSITVVRKLMNSLGQYGPAVALISVGFVHHSLWLTSVIFILGMGLNGAIYCG 403
            .|.::|.|: |:.||:..||||..:||.:.|.:.::.:.::.::.:.|.:...|........:||
  Rat   316 AGQMSDFLLSRKIFSVVAVRKLFTTLGIFCPVIFVVCLLYLSYNFYSTVIFLTLANSTLSFSFCG 380

  Fly   404 FKINHLDLSPRFAGLLISVTNCVANLVGLMAPMVAGHVIDPKPSVENWRIVFYIAAGVFIFTASF 468
            ..||.||::||:.|.|.:||..:....||::..:||.:::..|... |...|::.||:.:...:|
  Rat   381 QLINALDIAPRYYGFLKAVTALIGIFGGLISSTLAGLILNQDPEYA-WHKNFFLMAGINVTCLAF 444

  Fly   469 YNVFASGK-QQW 479
            |.:||.|. |.|
  Rat   445 YLLFAKGDIQDW 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6978NP_572188.1 2A0114euk 38..478 CDD:129972 133/451 (29%)
MFS 45..473 CDD:119392 129/438 (29%)
Slc17a1NP_598238.2 2A0114euk 1..464 CDD:129972 138/467 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.