DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6978 and SLC17A4

DIOPT Version :9

Sequence 1:NP_572188.1 Gene:CG6978 / 31413 FlyBaseID:FBgn0029727 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_005486.1 Gene:SLC17A4 / 10050 HGNCID:10932 Length:497 Species:Homo sapiens


Alignment Length:495 Identity:154/495 - (31%)
Similarity:251/495 - (50%) Gaps:35/495 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TAGVYDSKGVSNRNRSDQEVRMERYASDGQIPRCRKTRFFVVLMLFSGMANAYVMRTNMSVAIVA 68
            |.|...|.|  |.|.:.:|...:.:.|         .|..:.|:|.....:.|..:.|:|:||.|
Human    10 TVGDISSDG--NLNVAQEECSRKGFCS---------VRHGLALILQLCNFSIYTQQMNLSIAIPA 63

  Fly    69 MVNHTA-ISHTKSSTQSKERDGD----------------FEWSYKLQGYILSSFFYGYVITQIPF 116
            |||:|| .|...:||:....|..                ::||.::||.||||..||..:..||.
Human    64 MVNNTAPPSQPNASTERPSTDSQGYWNETLKEFKAMAPAYDWSPEIQGIILSSLNYGSFLAPIPS 128

  Fly   117 GLMIKYYGARHFLGWGMMINSLAAFFIPISARSGGVVGLCVVRFIQGLGEGPIVPCSHSLLAQWV 181
            |.:...:||::.:|.|:.|:|....|||::| :.||..|.|:|.:||:.:..::...:|:..:|.
Human   129 GYVAGIFGAKYVVGAGLFISSFLTLFIPLAA-NAGVALLIVLRIVQGIAQVMVLTGQYSIWVKWA 192

  Fly   182 PPNERSLAGAAVYAGAQFGTIVSMPLSGLLAHYGFDGGWPSIFYIFGLFSTIWCIIFICLVQESP 246
            ||.|||.......:|:..|:.:.:...|||..   ..|||.:|||||......|.::..|:.:.|
Human   193 PPLERSQLTTIAGSGSMLGSFIVLLAGGLLCQ---TIGWPYVFYIFGGIGCACCPLWFPLIYDDP 254

  Fly   247 AVSTRISEAERRHIMEAIWQAQPEERSRIPFLGIAKSPPFYAILVAHAGHNYGYETLMTMLPTYM 311
            .....||..|:|:|:.::.|........:|...:.||.|.:||||::....:.:.|:|...|||:
Human   255 VNHPFISAGEKRYIVCSLAQQDCSPGWSLPIRAMIKSLPLWAILVSYFCEYWLFYTIMAYTPTYI 319

  Fly   312 YRVLNVNIRTNGIISSLPYLAMWILAIVFGILADCLI-RRNFSITVVRKLMNSLGQYGPAVALIS 375
            ..||..|:|.:||:|:||::...|..|:.|:|||.|: |:...:..:|||..::|...|:|.|:|
Human   320 SSVLQANLRDSGILSALPFVVGCICIILGGLLADFLLSRKILRLITIRKLFTAIGVLFPSVILVS 384

  Fly   376 VGFVHHSLWLTSVIFILGMGLNGAIYCGFKINHLDLSPRFAGLLISVTNCVANLVGLMAPMVAGH 440
            :.:|..|..:|....:|...::.....|..:|.||::||:.|.|..:....|::.|.::|..||.
Human   385 LPWVRSSHSMTMTFLVLSSAISSFCESGALVNFLDIAPRYTGFLKGLLQVFAHIAGAISPTAAGF 449

  Fly   441 VIDPKPSVENWRIVFYIAAGVFIFTASFYNVFA-SGKQQW 479
            .|. :.|...||.||.::|.|.|....||.:|. :..|.|
Human   450 FIS-QDSEFGWRNVFLLSAAVNISGLVFYLIFGRADVQDW 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6978NP_572188.1 2A0114euk 38..478 CDD:129972 144/458 (31%)
MFS 45..473 CDD:119392 142/445 (32%)
SLC17A4NP_005486.1 UhpC 30..491 CDD:332119 147/473 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148637
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.