powered by:
Protein Alignment CG15471 and AT1G55000
DIOPT Version :9
Sequence 1: | NP_001138156.1 |
Gene: | CG15471 / 31412 |
FlyBaseID: | FBgn0029726 |
Length: | 128 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001031192.1 |
Gene: | AT1G55000 / 841942 |
AraportID: | AT1G55000 |
Length: | 221 |
Species: | Arabidopsis thaliana |
Alignment Length: | 49 |
Identity: | 17/49 - (34%) |
Similarity: | 26/49 - (53%) |
Gaps: | 0/49 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 HSITAEDTMTRLALKYDTSIGRICRANRMHSQDVLQARRHVWVPIPNSQ 74
|.|...|::|.||:||...:..|.|.|.|.|...:.:|..:.:||.|.:
plant 76 HRICRGDSVTSLAVKYAVQVMDIKRLNNMMSDHGIYSRDRLLIPISNPE 124
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG15471 | NP_001138156.1 |
LysM |
26..69 |
CDD:279777 |
14/42 (33%) |
AT1G55000 | NP_001031192.1 |
F-box-like |
9..40 |
CDD:403981 |
|
LysM |
74..118 |
CDD:212030 |
14/41 (34%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2850 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.