DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15471 and AT5G23130

DIOPT Version :9

Sequence 1:NP_001138156.1 Gene:CG15471 / 31412 FlyBaseID:FBgn0029726 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_197704.2 Gene:AT5G23130 / 832377 AraportID:AT5G23130 Length:397 Species:Arabidopsis thaliana


Alignment Length:81 Identity:17/81 - (20%)
Similarity:36/81 - (44%) Gaps:16/81 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DRGPN-ICNCSRM-------------RSEC--WTRHSITAEDTMTRLALKYDTSIGRICRANRMH 55
            :|.|: .|:.|::             .|.|  :..|.::..||:..:|:||...:..|.:.|.:.
plant    37 ERSPSRSCSVSKILRITPPTSSPPSSASTCAGYIEHRVSKFDTLAGIAIKYGVEVADITKLNGLV 101

  Fly    56 SQDVLQARRHVWVPIP 71
            :...:.|...:.:|:|
plant   102 TDLQMFALESLRIPLP 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15471NP_001138156.1 LysM 26..69 CDD:279777 9/42 (21%)
AT5G23130NP_197704.2 LysM 70..114 CDD:212030 9/43 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.