powered by:
Protein Alignment CG15471 and lysmd1
DIOPT Version :9
Sequence 1: | NP_001138156.1 |
Gene: | CG15471 / 31412 |
FlyBaseID: | FBgn0029726 |
Length: | 128 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001070218.1 |
Gene: | lysmd1 / 791996 |
ZFINID: | ZDB-GENE-060929-1094 |
Length: | 211 |
Species: | Danio rerio |
Alignment Length: | 66 |
Identity: | 20/66 - (30%) |
Similarity: | 37/66 - (56%) |
Gaps: | 3/66 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 HSITAEDTMTRLALKYDTSIGRICRANRMHSQDVLQARRHVWVPI--PNSQFQMGCQEKSESDES 88
|.:...:|:..|:|||..|:.:|.||||:::.:.:..:..::||: .:..|..|. |.:|...|
Zfish 42 HIVQPGETLQGLSLKYGVSMEQIKRANRLYTNESIFLKESLFVPVLTESVSFTNGV-ELTEEKTS 105
Fly 89 P 89
|
Zfish 106 P 106
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG15471 | NP_001138156.1 |
LysM |
26..69 |
CDD:279777 |
12/42 (29%) |
lysmd1 | NP_001070218.1 |
LysM |
40..84 |
CDD:212030 |
12/41 (29%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003034 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.