DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15471 and Lysmd4

DIOPT Version :9

Sequence 1:NP_001138156.1 Gene:CG15471 / 31412 FlyBaseID:FBgn0029726 Length:128 Species:Drosophila melanogaster
Sequence 2:XP_003748928.1 Gene:Lysmd4 / 681647 RGDID:1592887 Length:310 Species:Rattus norvegicus


Alignment Length:130 Identity:29/130 - (22%)
Similarity:48/130 - (36%) Gaps:28/130 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RHSITAEDTMTRLALKYDTSIGRICRANRMHSQDVLQARRHVWVPIPN---------SQFQMGCQ 80
            :..:..||::.:|||:|...:..|.:||....:..|.|.:.:.:|:.|         ....:|..
  Rat    89 QRELAQEDSLNKLALQYGCKVADIKKANNFIREQDLYALKSIKIPVRNHGILTETHQELMPLGAS 153

  Fly    81 EKS------ESDESPEISIRKVTPNLPSHFYRQSDPN------PNPFACD-------DDPLLVIT 126
            ...      |..|..:.|......|..:.|::..|.|      .:.|..|       |.|||.||
  Rat   154 SSETRVTLVELPEDGDASGATAQGNQLTEFFKGIDENIERAVQSDVFHSDGCCVEAPDQPLLPIT 218

  Fly   127  126
              Rat   219  218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15471NP_001138156.1 LysM 26..69 CDD:279777 11/42 (26%)
Lysmd4XP_003748928.1 LysM 94..132 CDD:197609 11/37 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.