DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15471 and red

DIOPT Version :10

Sequence 1:NP_572187.2 Gene:CG15471 / 31412 FlyBaseID:FBgn0029726 Length:128 Species:Drosophila melanogaster
Sequence 2:XP_061504405.1 Gene:red / 5667715 VectorBaseID:AGAMI1_005992 Length:335 Species:Anopheles gambiae


Alignment Length:75 Identity:24/75 - (32%)
Similarity:35/75 - (46%) Gaps:11/75 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RHSITAEDTMTRLALKYDTSIGRICRANRMHSQDVLQARRHVWVPIPNSQFQMGCQEKSESDESP 89
            ||.:...||:..|||||..|:.:|.|.||:...|.:..|..:.||:        .::.....:.|
Mosquito    74 RHDVERTDTLQGLALKYGCSMEQIRRVNRLLPTDTIFLRPFLMVPV--------AKDSPHYPKDP 130

  Fly    90 EISIRKVTPN 99
            |..||   ||
Mosquito   131 EAIIR---PN 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15471NP_572187.2 LysM 26..69 CDD:396179 15/42 (36%)
redXP_061504405.1 None

Return to query results.
Submit another query.