DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15471 and lysmd2

DIOPT Version :10

Sequence 1:NP_572187.2 Gene:CG15471 / 31412 FlyBaseID:FBgn0029726 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001003507.1 Gene:lysmd2 / 445113 ZFINID:ZDB-GENE-040801-250 Length:208 Species:Danio rerio


Alignment Length:120 Identity:33/120 - (27%)
Similarity:53/120 - (44%) Gaps:22/120 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASLTEDRGPNICNCSRMRSECWTRHSITAEDTMTRLALKYDTSIGRICRANRMHSQDVLQARRHV 66
            ||:|...|           |.:..|.:|..:|:..:||||..::.:|.|.|::.|.|.:..|..:
Zfish    54 ASVTAPLG-----------EKYIEHRVTDGETLQGIALKYGVTMEQIKRVNKLFSNDCIFLRNTL 107

  Fly    67 WVPIPN---SQFQMGCQEKSESD-----ESPEISIRKVTPNLPSHFYRQSDPNPN 113
            .:|:.:   |.|.....|..:|:     |||.:|.....|:.|.   ..|.|.||
Zfish   108 SIPVKSEKRSLFNGLSLESPDSEGNTPQESPCVSQDVDAPSPPP---EPSVPEPN 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15471NP_572187.2 LysM 26..69 CDD:396179 13/42 (31%)
lysmd2NP_001003507.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54 33/120 (28%)
LysM 65..109 CDD:212030 13/43 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..169 12/41 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..208
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.