DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15471 and red

DIOPT Version :9

Sequence 1:NP_001138156.1 Gene:CG15471 / 31412 FlyBaseID:FBgn0029726 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001247097.1 Gene:red / 41738 FlyBaseID:FBgn0285913 Length:366 Species:Drosophila melanogaster


Alignment Length:68 Identity:25/68 - (36%)
Similarity:37/68 - (54%) Gaps:2/68 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GPNICNCSRMRSECWTRHSITAEDTMTRLALKYDTSIGRICRANRMHSQDVLQARRHVWVPI-PN 72
            |...||..| .:|...||.:...||:..:||||..:..:|.||||:.:.|.|..|:.:.||: .|
  Fly    48 GSTCCNSLR-NNETLIRHIVEKTDTLQGIALKYGCTTEQIRRANRLFASDSLFLRQFLLVPVEKN 111

  Fly    73 SQF 75
            |.:
  Fly   112 SPY 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15471NP_001138156.1 LysM 26..69 CDD:279777 15/42 (36%)
redNP_001247097.1 LysM 62..106 CDD:212030 16/43 (37%)
LysM <64..113 CDD:224306 18/48 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.