powered by:
Protein Alignment CG15471 and red
DIOPT Version :9
Sequence 1: | NP_001138156.1 |
Gene: | CG15471 / 31412 |
FlyBaseID: | FBgn0029726 |
Length: | 128 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001247097.1 |
Gene: | red / 41738 |
FlyBaseID: | FBgn0285913 |
Length: | 366 |
Species: | Drosophila melanogaster |
Alignment Length: | 68 |
Identity: | 25/68 - (36%) |
Similarity: | 37/68 - (54%) |
Gaps: | 2/68 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 GPNICNCSRMRSECWTRHSITAEDTMTRLALKYDTSIGRICRANRMHSQDVLQARRHVWVPI-PN 72
|...||..| .:|...||.:...||:..:||||..:..:|.||||:.:.|.|..|:.:.||: .|
Fly 48 GSTCCNSLR-NNETLIRHIVEKTDTLQGIALKYGCTTEQIRRANRLFASDSLFLRQFLLVPVEKN 111
Fly 73 SQF 75
|.:
Fly 112 SPY 114
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003034 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.