powered by:
Protein Alignment CG15471 and lysmd3
DIOPT Version :9
Sequence 1: | NP_001138156.1 |
Gene: | CG15471 / 31412 |
FlyBaseID: | FBgn0029726 |
Length: | 128 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001002104.1 |
Gene: | lysmd3 / 415194 |
ZFINID: | ZDB-GENE-040625-88 |
Length: | 305 |
Species: | Danio rerio |
Alignment Length: | 68 |
Identity: | 17/68 - (25%) |
Similarity: | 31/68 - (45%) |
Gaps: | 9/68 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 SLTEDRGPNICNCSRMRSECWTRHSITAEDTMTRLALKYDTSIGRICRANRMHSQDVLQARRHVW 67
|.:.||..:|....| .|...||:..::|:|..::..|.|||.:.::....|.|.:.
Zfish 56 STSRDRKDDIVYLIR---------EIKEGDTLISISLQYFCTVADIKRANNLLTEQDFFALRSLR 111
Fly 68 VPI 70
:|:
Zfish 112 IPV 114
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2850 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.