DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15471 and lysmd3

DIOPT Version :10

Sequence 1:NP_572187.2 Gene:CG15471 / 31412 FlyBaseID:FBgn0029726 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001002104.1 Gene:lysmd3 / 415194 ZFINID:ZDB-GENE-040625-88 Length:305 Species:Danio rerio


Alignment Length:68 Identity:17/68 - (25%)
Similarity:31/68 - (45%) Gaps:9/68 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLTEDRGPNICNCSRMRSECWTRHSITAEDTMTRLALKYDTSIGRICRANRMHSQDVLQARRHVW 67
            |.:.||..:|....|         .|...||:..::|:|..::..|.|||.:.::....|.|.:.
Zfish    56 STSRDRKDDIVYLIR---------EIKEGDTLISISLQYFCTVADIKRANNLLTEQDFFALRSLR 111

  Fly    68 VPI 70
            :|:
Zfish   112 IPV 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15471NP_572187.2 LysM 26..69 CDD:396179 11/42 (26%)
lysmd3NP_001002104.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..60 1/3 (33%)
LysM 72..112 CDD:212030 11/39 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..156
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.