DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15471 and Lysmd3

DIOPT Version :10

Sequence 1:NP_572187.2 Gene:CG15471 / 31412 FlyBaseID:FBgn0029726 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001009698.1 Gene:Lysmd3 / 315923 RGDID:1308805 Length:300 Species:Rattus norvegicus


Alignment Length:90 Identity:21/90 - (23%)
Similarity:40/90 - (44%) Gaps:12/90 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DTMTRLALKYDTSIGRICRANRMHSQDVLQARRHVWVPIPNSQFQMGCQEKSESDESPEISIRKV 96
            ||:..:||:|..::..|.|.|.:.|.....|.|.:.:|:  .:|      .|.::....:..|:|
  Rat    73 DTLNAVALQYCCTVADIKRVNNLISDQDFFALRSIKIPV--KRF------SSLTETLHPLKGRQV 129

  Fly    97 TPNLPSHFYRQSDPNPNPFACDDDP 121
            ....|..::::.|..|    .:|.|
  Rat   130 LHPPPVPYFQEQDTVP----ANDSP 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15471NP_572187.2 LysM 26..69 CDD:396179 11/36 (31%)
Lysmd3NP_001009698.1 LysM <69..112 CDD:440998 12/40 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..157 4/19 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..300
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.