DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15471 and LYSMD2

DIOPT Version :10

Sequence 1:NP_572187.2 Gene:CG15471 / 31412 FlyBaseID:FBgn0029726 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_699205.1 Gene:LYSMD2 / 256586 HGNCID:28571 Length:215 Species:Homo sapiens


Alignment Length:109 Identity:24/109 - (22%)
Similarity:49/109 - (44%) Gaps:31/109 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HSITAEDTMTRLALKYDTSIGRICRANRMHSQDVLQARRHVWVPIPNSQFQMGCQEKS------E 84
            |.:.|.||:..:||||..::.:|.|||::.:.|.:..::.:.:|:        ..||.      .
Human    73 HRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPV--------ISEKPLLFNGLN 129

  Fly    85 SDESPEISIRKVTPNLPSHFYRQSDPNPNPFACDDDPLLVITDM 128
            |.:|||                 ::...|.|:.:::|::...|:
Human   130 SIDSPE-----------------NETADNSFSQEEEPVVAGEDL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15471NP_572187.2 LysM 26..69 CDD:396179 13/42 (31%)
LYSMD2NP_699205.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
LysM <45..117 CDD:440998 13/43 (30%)
Nup88 <101..206 CDD:462975 12/81 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..175 7/42 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..215
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.