DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15471 and Lysmd1

DIOPT Version :10

Sequence 1:NP_572187.2 Gene:CG15471 / 31412 FlyBaseID:FBgn0029726 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_694761.1 Gene:Lysmd1 / 217779 MGIID:1919409 Length:226 Species:Mus musculus


Alignment Length:81 Identity:25/81 - (30%)
Similarity:44/81 - (54%) Gaps:5/81 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NCSRMRSECWTRHSITAEDTMTRLALKYDTSIGRICRANRMHSQDVLQARRHVWVPI---PNSQF 75
            :||.:| |....|.:...||:..|||||..::.:|.|.||:::.|.:..::.:::||   |...|
Mouse    31 SCSPVR-ERRLEHQLEPGDTLAGLALKYGVTMEQIKRTNRLYTNDSIFLKKTLYIPILSEPRDLF 94

  Fly    76 QMGCQEKSESDESPEI 91
            . |...:.|:|...|:
Mouse    95 N-GLDSEEENDGEEEV 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15471NP_572187.2 LysM 26..69 CDD:396179 13/42 (31%)
Lysmd1NP_694761.1 LysM 42..84 CDD:212030 13/41 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..156 4/16 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..226
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.