DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15471 and lmd-2

DIOPT Version :9

Sequence 1:NP_001138156.1 Gene:CG15471 / 31412 FlyBaseID:FBgn0029726 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_491415.2 Gene:lmd-2 / 172073 WormBaseID:WBGene00015008 Length:159 Species:Caenorhabditis elegans


Alignment Length:131 Identity:32/131 - (24%)
Similarity:65/131 - (49%) Gaps:26/131 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TEDRGPNICNCSRMRSECWTRHSITAEDTMTRLALKYDTSIGRICRANRMHSQDVLQARRHVWVP 69
            |:.:...:..||      :|.:.:..:||:.|:|||::.|:..:.|||::.|...|..::.:.:|
 Worm    36 TQSQSSPVTPCS------YTIYQVQTDDTLERIALKHNCSVSSLVRANKLWSPSALFMKQFIRIP 94

  Fly    70 IPNSQ--------FQMGCQ---------EKSESDESPEISIRKVTPNLPSHFYRQSDPNPNPFAC 117
            |.|||        .:..|:         :.|..::|.:..::::..|:.|  :|:.| ||:..|.
 Worm    95 IFNSQQPNLKPSLQETQCKIVPATTERVDSSREEKSMKDILQRIDRNIKS--FRKCD-NPSSSAY 156

  Fly   118 D 118
            |
 Worm   157 D 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15471NP_001138156.1 LysM 26..69 CDD:279777 12/42 (29%)
lmd-2NP_491415.2 LysM 50..93 CDD:197609 12/42 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.