powered by:
Protein Alignment CG15471 and LYSMD3
DIOPT Version :9
Sequence 1: | NP_001138156.1 |
Gene: | CG15471 / 31412 |
FlyBaseID: | FBgn0029726 |
Length: | 128 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_938014.1 |
Gene: | LYSMD3 / 116068 |
HGNCID: | 26969 |
Length: | 306 |
Species: | Homo sapiens |
Alignment Length: | 72 |
Identity: | 19/72 - (26%) |
Similarity: | 30/72 - (41%) |
Gaps: | 12/72 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 DTMTRLALKYDTSIGRICRANRMHSQDVLQARRHVWVPIP--NSQFQMGCQEKSE---------- 84
||:..:||:|..::..|.|.|.:.|.....|.|.:.:|:. :|..:..|..|..
Human 73 DTLNAIALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKKFSSLTETLCPPKGRQTSRHSSVQY 137
Fly 85 SDESPEI 91
|.|..||
Human 138 SSEQQEI 144
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG15471 | NP_001138156.1 |
LysM |
26..69 |
CDD:279777 |
11/36 (31%) |
LYSMD3 | NP_938014.1 |
LysM |
69..109 |
CDD:212030 |
11/35 (31%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2850 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.