DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15471 and LYSMD3

DIOPT Version :10

Sequence 1:NP_572187.2 Gene:CG15471 / 31412 FlyBaseID:FBgn0029726 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_938014.1 Gene:LYSMD3 / 116068 HGNCID:26969 Length:306 Species:Homo sapiens


Alignment Length:72 Identity:19/72 - (26%)
Similarity:30/72 - (41%) Gaps:12/72 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DTMTRLALKYDTSIGRICRANRMHSQDVLQARRHVWVPIP--NSQFQMGCQEKSE---------- 84
            ||:..:||:|..::..|.|.|.:.|.....|.|.:.:|:.  :|..:..|..|..          
Human    73 DTLNAIALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKKFSSLTETLCPPKGRQTSRHSSVQY 137

  Fly    85 SDESPEI 91
            |.|..||
Human   138 SSEQQEI 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15471NP_572187.2 LysM 26..69 CDD:396179 11/36 (31%)
LYSMD3NP_938014.1 LysM <69..112 CDD:440998 12/38 (32%)

Return to query results.
Submit another query.