DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15471 and lysmd1

DIOPT Version :9

Sequence 1:NP_001138156.1 Gene:CG15471 / 31412 FlyBaseID:FBgn0029726 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001096341.1 Gene:lysmd1 / 100124927 XenbaseID:XB-GENE-989799 Length:218 Species:Xenopus tropicalis


Alignment Length:128 Identity:29/128 - (22%)
Similarity:53/128 - (41%) Gaps:33/128 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HSITAEDTMTRLALKYDTSIGRICRANRMHSQDVLQARRHVWVPI----------PNSQFQMGCQ 80
            |.:...||:..|||:|..::.:|.||||:::.|.:..::.:.:|:          .|||...|.:
 Frog    39 HQVQPGDTLQGLALRYGVTMEQIKRANRLYTNDSIFLKKSLCIPVLADQLHLSDDQNSQDGSGAE 103

  Fly    81 --------EKSESDESPEISIRKVTPNLPSHFYRQSDPN--------------PNPFACDDDP 121
                    |:.|..:|...:.:|...: |..|..:.|.|              ...|..:|:|
 Frog   104 GSPIQQQPERGEKQKSRHHAAQKDEMS-PLDFMSRLDTNIRVSKRAAVKKLREGESFTTEDEP 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15471NP_001138156.1 LysM 26..69 CDD:279777 13/42 (31%)
lysmd1NP_001096341.1 LysM 39..82 CDD:366664 13/42 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003034
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.