DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and CRZ1

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_014371.1 Gene:CRZ1 / 855704 SGDID:S000004972 Length:678 Species:Saccharomyces cerevisiae


Alignment Length:252 Identity:66/252 - (26%)
Similarity:97/252 - (38%) Gaps:60/252 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SGGNYNQLEFEESD---YYGIITLDSNNNTNTNGNIQVGLPHVEDPSLFIDFNDLTVCPPDLS-- 105
            |..|.|..|..::|   .|..|...:.|..|.|.|:....|.:|...:.|. |:|.....||.  
Yeast   453 SSENDNNRERYDNDSKTSYNTINSSNFNEDNNNNNLLTSKPKIESGIVNIK-NELDDTSKDLGIL 516

  Fly   106 -DWEQRLLDNYVEIPDLVDFLPERTPLCTDNCADFLEESNSNLRLSGPPHSEIFVPDRSSSSPGS 169
             |     :|:..:....|.|..:      ||     .|:|                |..:.|...
Yeast   517 LD-----IDSLGQFEQKVGFKND------DN-----HENN----------------DNGTFSVKK 549

  Fly   170 SDSASPAEAVAPPSALQMSENAAGERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDC 234
            :|:....::|        :.|......:.|..  |.|.:.:|.:||:|||.|..|:|::||  .|
Yeast   550 NDNLEKLDSV--------TNNRKNPANFACDV--CGKKFTRPYNLKSHLRTHTNERPFICS--IC 602

  Fly   235 VWRFSRSDELARHKRSHSGVKPYKCD---------YCSKCFARSDHLTKHRKVHERR 282
            ...|:|..:..||:..|:|.|.|.|.         .|.|.|||||.|.:|.|....|
Yeast   603 GKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTESGR 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 33/87 (38%)
C2H2 Zn finger 203..221 CDD:275368 8/17 (47%)
C2H2 Zn finger 229..251 CDD:275368 7/21 (33%)
zf-H2C2_2 243..268 CDD:290200 10/33 (30%)
C2H2 Zn finger 259..279 CDD:275368 11/28 (39%)
CRZ1NP_014371.1 COG5048 139..617 CDD:227381 50/208 (24%)
C2H2 Zn finger 571..591 CDD:275368 9/21 (43%)
C2H2 Zn finger 599..619 CDD:275368 7/21 (33%)
C2H2 Zn finger 627..655 CDD:275368 10/27 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.