DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and MSN2

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_013751.1 Gene:MSN2 / 855053 SGDID:S000004640 Length:704 Species:Saccharomyces cerevisiae


Alignment Length:294 Identity:67/294 - (22%)
Similarity:109/294 - (37%) Gaps:101/294 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SNNNTNTN----------GNIQVGLPHVEDPSLFIDF---------NDLTVCPPDLSDWEQRLLD 113
            |:||::||          ...:..||.::| ||..|.         ||: :...:||..:|.:..
Yeast   428 SHNNSSTNMKSFNSDLYSRRQRASLPIIDD-SLSYDLVNKQDEDPKNDM-LPNSNLSSSQQFIKP 490

  Fly   114 NYVEIPDLVDFLPERTPLCTDNCADFL-EESNSNLRLSGPPHSEIFVPDRSSS--SPGSSDSAS- 174
            :.: :.|....:.:.......|...|| ||...|  .:..|:.::.:...:.:  ||.||.|.| 
Yeast   491 SMI-LSDNASVIAKVATTGLSNDMPFLTEEGEQN--ANSTPNFDLSITQMNMAPLSPASSSSTSL 552

  Fly   175 --------------------------------PAEAVAP---------PSALQMSENAAG---ER 195
                                            |.....|         .|::..:.|.||   ||
Yeast   553 ATNHFYHHFPQQGHHTMNSKIGSSLRRRKSAVPLMGTVPLTNQQNNISSSSVNSTGNGAGVTKER 617

  Fly   196 GYLCTFGNCEKIYAKPAHLKAHL------------RRHLGEKPYVCSWPDCVWRFSRSDELARHK 248
                          :|::.:..:            .:.|.|||:.|.  .|...|.||:.|.||.
Yeast   618 --------------RPSYRRKSMTPSRRSSVVIESTKELEEKPFHCH--ICPKSFKRSEHLKRHV 666

  Fly   249 RS-HSGVKPYKCDYCSKCFARSDHLTKHRKVHER 281
            || ||..:|:.|..|.|.|:|||:|::|.|.|::
Yeast   667 RSVHSNERPFACHICDKKFSRSDNLSQHIKTHKK 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 27/91 (30%)
C2H2 Zn finger 203..221 CDD:275368 1/29 (3%)
C2H2 Zn finger 229..251 CDD:275368 10/22 (45%)
zf-H2C2_2 243..268 CDD:290200 12/25 (48%)
C2H2 Zn finger 259..279 CDD:275368 10/19 (53%)
MSN2NP_013751.1 COG5048 127..594 CDD:227381 32/170 (19%)
zf-C2H2_4 647..670 CDD:404733 10/24 (42%)
C2H2 Zn finger 649..670 CDD:275368 10/22 (45%)
zf-H2C2_2 661..687 CDD:404364 12/25 (48%)
zf-C2H2 676..698 CDD:395048 10/21 (48%)
C2H2 Zn finger 678..698 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.