DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and Klf15

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_445988.2 Gene:Klf15 / 85497 RGDID:70918 Length:415 Species:Rattus norvegicus


Alignment Length:178 Identity:84/178 - (47%)
Similarity:104/178 - (58%) Gaps:34/178 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LPERTPLCTDNCADFLEESNSNLRLSGPPHSEIFV---PDRSSSSPGSSDSASPAEAVAPPSAL- 185
            ||:..|             :|||.||..     ||   |...::.|..|.|..|.     |:.| 
  Rat   262 LPQVVP-------------SSNLNLSSK-----FVRIAPVPIAAKPIGSGSLGPG-----PAGLL 303

  Fly   186 ---QMSENAAGE--RGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELA 245
               :..:|.|.|  :.:.|||..|.|:|.|.:|||||||||.||||:.|:||.|.|||||||||:
  Rat   304 VGQKFPKNPAAELLKMHKCTFPGCSKMYTKSSHLKAHLRRHTGEKPFACTWPGCGWRFSRSDELS 368

  Fly   246 RHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVHERRLLAASRAGRSL 293
            ||:|||||||||:|..|.|.|||||||:||.|||  |...:|||.|::
  Rat   369 RHRRSHSGVKPYQCPVCEKKFARSDHLSKHIKVH--RFPRSSRAVRAI 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 56/78 (72%)
C2H2 Zn finger 203..221 CDD:275368 11/17 (65%)
C2H2 Zn finger 229..251 CDD:275368 16/21 (76%)
zf-H2C2_2 243..268 CDD:290200 17/24 (71%)
C2H2 Zn finger 259..279 CDD:275368 13/19 (68%)
Klf15NP_445988.2 KLF15_N 3..320 CDD:410206 15/60 (25%)
SFP1 <318..400 CDD:227516 50/87 (57%)
C2H2 Zn finger 322..344 CDD:275368 8/27 (30%)
C2H2 Zn finger 352..374 CDD:275368 15/21 (71%)
C2H2 Zn finger 382..402 CDD:275368 13/19 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11426
eggNOG 1 0.900 - - E33208_3BHHA
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto97832
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4659
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.