DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and MSN4

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_012861.1 Gene:MSN4 / 853803 SGDID:S000001545 Length:630 Species:Saccharomyces cerevisiae


Alignment Length:282 Identity:65/282 - (23%)
Similarity:97/282 - (34%) Gaps:93/282 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 NNNTNTNGNIQVGLPHVEDPSLFIDFNDLTVCPPDLSDWEQRLLD----------NYVEIPDLVD 123
            :::::|....:..||.:.|...|.  ||..:..| |||....|.:          ||       :
Yeast   369 SHSSSTTRQQRASLPLIHDIESFA--NDSVMANP-LSDSASFLSEENEDDAFGALNY-------N 423

  Fly   124 FLPERTPLCTDNCADFLEESNSNLRLSGPPHSEIFVPDRSSSSPGSSDSA----SPAEAVAPPSA 184
            .|...|....||..|     ..|:..|.|...:.|:......|..:|.:|    |..:.:.|..|
Yeast   424 SLDATTMSAFDNNVD-----PFNILKSSPAQDQQFIKPSMMLSDNASAAAKLATSGVDNITPTPA 483

  Fly   185 LQMSENAAGERGYLCTFGNCEKIY----------------AKPAHLKAHLRRHLG---------- 223
            .|       .|.|..:..:..||.                .|.|.:..:.||...          
Yeast   484 FQ-------RRSYDISMNSSFKILPTSQAHHAAQHHQQQPTKQATVSPNTRRRKSSSVTLSPTIS 541

  Fly   224 ----------------------------EKPYVCSWPDCVWRFSRSDELARHKRS-HSGVKPYKC 259
                                        .||:.|.  ||...|.||:.|.||.|| ||..:|:.|
Yeast   542 HNNNNGKVPVQPRKRKSITTIDPNNYDKNKPFKCK--DCEKAFRRSEHLKRHIRSVHSTERPFAC 604

  Fly   260 DYCSKCFARSDHLTKHRKVHER 281
            .:|.|.|:|||:|::|.|.|::
Yeast   605 MFCEKKFSRSDNLSQHLKTHKK 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 31/133 (23%)
C2H2 Zn finger 203..221 CDD:275368 5/33 (15%)
C2H2 Zn finger 229..251 CDD:275368 11/22 (50%)
zf-H2C2_2 243..268 CDD:290200 12/25 (48%)
C2H2 Zn finger 259..279 CDD:275368 10/19 (53%)
MSN4NP_012861.1 COG5048 57..622 CDD:227381 63/276 (23%)
C2H2 Zn finger 575..596 CDD:275368 11/22 (50%)
C2H2 Zn finger 604..624 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.