DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and FZF1

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_011260.1 Gene:FZF1 / 852638 SGDID:S000003223 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:97 Identity:40/97 - (41%)
Similarity:52/97 - (53%) Gaps:0/97 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 RGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKC 259
            |.|.|:|..|||:|.:|:.|:.|...|..:|||.|..|.|..:|.|...|..||.:||.:||..|
Yeast    10 RNYKCSFDGCEKVYNRPSLLQQHQNSHTNQKPYHCDEPGCGKKFIRPCHLRVHKWTHSQIKPKAC 74

  Fly   260 DYCSKCFARSDHLTKHRKVHERRLLAASRAGR 291
            ..|.|.|..:..|.:|...|||:...|||..|
Yeast    75 TLCQKRFVTNQQLRRHLNSHERKSKLASRIDR 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 31/78 (40%)
C2H2 Zn finger 203..221 CDD:275368 7/17 (41%)
C2H2 Zn finger 229..251 CDD:275368 8/21 (38%)
zf-H2C2_2 243..268 CDD:290200 11/24 (46%)
C2H2 Zn finger 259..279 CDD:275368 6/19 (32%)
FZF1NP_011260.1 COG5048 15..297 CDD:227381 37/92 (40%)
C2H2 Zn finger 17..36 CDD:275368 7/18 (39%)
C2H2 Zn finger 44..66 CDD:275368 8/21 (38%)
C2H2 Zn finger 74..94 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto99938
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.900

Return to query results.
Submit another query.