DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and Klf5

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_445846.3 Gene:Klf5 / 84410 RGDID:621446 Length:443 Species:Rattus norvegicus


Alignment Length:163 Identity:60/163 - (36%)
Similarity:80/163 - (49%) Gaps:34/163 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 PPHSEIFVPDRSSSSPGSSD-SASPAEAVAPPSAL------------------------------ 185
            |..:..|.|...||.|||.| .|...:.:.||.:.                              
  Rat   280 PQQATYFPPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPATLPVNSPNIQPVR 344

  Fly   186 ---QMSENAAGERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARH 247
               :.:.:....|.:.|.:..|.|:|.|.:|||||||.|.|||||.|:|..|.|||:|||||.||
  Rat   345 YNRRSNPDLEKRRIHFCDYDGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRH 409

  Fly   248 KRSHSGVKPYKCDYCSKCFARSDHLTKHRKVHE 280
            .|.|:|.||::|..|::.|:|||||..|.|.|:
  Rat   410 YRKHTGAKPFQCVVCNRSFSRSDHLALHMKRHQ 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 45/78 (58%)
C2H2 Zn finger 203..221 CDD:275368 11/17 (65%)
C2H2 Zn finger 229..251 CDD:275368 14/21 (67%)
zf-H2C2_2 243..268 CDD:290200 12/24 (50%)
C2H2 Zn finger 259..279 CDD:275368 10/19 (53%)
Klf5NP_445846.3 KLF5_N 3..356 CDD:410335 12/75 (16%)
COG5048 345..>419 CDD:227381 36/73 (49%)
C2H2 Zn finger 361..383 CDD:275368 12/21 (57%)
C2H2 Zn finger 391..413 CDD:275368 14/21 (67%)
zf-H2C2_2 405..430 CDD:404364 12/24 (50%)
zf-C2H2 419..441 CDD:395048 10/21 (48%)
C2H2 Zn finger 421..441 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.