DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and klf12a

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_021331523.1 Gene:klf12a / 798629 ZFINID:ZDB-GENE-030131-9188 Length:380 Species:Danio rerio


Alignment Length:269 Identity:79/269 - (29%)
Similarity:117/269 - (43%) Gaps:60/269 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SNNNTNTNGNIQVGLPHVEDPSLFIDFNDLTVCP----PDLSDWEQRLL--DNYVEIPDL----- 121
            |:.:..::....:.:|.....|:......|.:.|    |.:|....|.|  .:::.||.|     
Zfish   108 SSKSLPSSSPSSLSMPSSSSTSVITPVPRLKMSPSCSVPVVSSLPSRGLRGQSFLHIPQLMPPCS 172

  Fly   122 --VDFLPERTPLCTDN----------------CADFLEESNSNLRLSGPPH--SEIFVPDRSSSS 166
              |...|.|.|:....                ....|||:..:.::.   |  ::...|.||.|.
Zfish   173 SPVHIHPRRVPVVVQPMPLVYPGVGSLGSSRLMMPLLEENRMHRKVM---HRMADGLSPRRSLSD 234

  Fly   167 PGSSD-----------SASPAEAVAP-------PSALQM--------SENAAGERGYLCTFGNCE 205
            ....|           :.|.|..:|.       |.:::.        |.::...|.:.|.|..|.
Zfish   235 SEDDDLPNVTLESVNETGSTALTIARAVQDSLLPFSIESLRRPRPSESPDSKRRRIHRCEFEGCN 299

  Fly   206 KIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSD 270
            |:|.|.:|||||.|.|.|||||.|:|.:|.|:|:|||||.||.|.|:||||:||..|.:.|:|||
Zfish   300 KVYTKSSHLKAHRRTHTGEKPYKCTWDNCTWKFARSDELTRHYRKHTGVKPFKCSDCDRSFSRSD 364

  Fly   271 HLTKHRKVH 279
            ||..||:.|
Zfish   365 HLALHRRRH 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 47/78 (60%)
C2H2 Zn finger 203..221 CDD:275368 10/17 (59%)
C2H2 Zn finger 229..251 CDD:275368 13/21 (62%)
zf-H2C2_2 243..268 CDD:290200 14/24 (58%)
C2H2 Zn finger 259..279 CDD:275368 10/19 (53%)
klf12aXP_021331523.1 SFP1 <217..370 CDD:227516 57/155 (37%)
C2H2 Zn finger 296..315 CDD:275368 10/18 (56%)
C2H2 Zn finger 323..345 CDD:275368 13/21 (62%)
zf-H2C2_2 337..362 CDD:316026 14/24 (58%)
C2H2 Zn finger 353..373 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.