DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and klf6b

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_001920652.2 Gene:klf6b / 793760 ZFINID:ZDB-GENE-070912-633 Length:245 Species:Danio rerio


Alignment Length:235 Identity:86/235 - (36%)
Similarity:111/235 - (47%) Gaps:54/235 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 IDFNDLTVCPPDLSDWEQ------RLLDN--YVEIPDLVDFLPERTPLCTDNC-ADFLEESNSNL 147
            :|...|:..|.....|:|      |.|.|  ||...||      |:...:||. :.|:....:..
Zfish    17 LDTGYLSALPSLEEYWQQTCLELERYLQNEPYVSAADL------RSVCESDNLWSQFVRCCGTEA 75

  Fly   148 RLSGPPHSEIFVPDRSSSSPGSS-------------------DSASPAEAV---APPSALQM-SE 189
            .|| ||.:.|...|..::|..||                   .:||..:.|   .|||:..: .|
Zfish    76 NLS-PPGASIPRQDEIAASCHSSFGSCEKIIASADVHTHPLGHNASEQQCVIAHTPPSSPSLVKE 139

  Fly   190 NAAGERG---------------YLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFS 239
            :|.|.||               :.|.|..|.|:|.|.:|||||.|.|.|||||.|||..|.|||:
Zfish   140 DADGPRGEEVRGEGSPEGRRRAHRCYFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFA 204

  Fly   240 RSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVH 279
            |||||.||.|.|:|.||:||.:|.:||:|||||..|.|.|
Zfish   205 RSDELTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMKRH 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 48/78 (62%)
C2H2 Zn finger 203..221 CDD:275368 10/17 (59%)
C2H2 Zn finger 229..251 CDD:275368 15/21 (71%)
zf-H2C2_2 243..268 CDD:290200 14/24 (58%)
C2H2 Zn finger 259..279 CDD:275368 11/19 (58%)
klf6bXP_001920652.2 C2H2 Zn finger 167..186 CDD:275368 10/18 (56%)
COG5048 176..>227 CDD:227381 33/50 (66%)
C2H2 Zn finger 194..216 CDD:275368 15/21 (71%)
zf-C2H2 222..244 CDD:306579 12/21 (57%)
C2H2 Zn finger 224..244 CDD:275368 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.