DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Klf15 and ZNF140

DIOPT Version :9

Sequence 1:	NP_572185.1	Gene:	Klf15 / 31410	FlyBaseID:	FBgn0025679	Length:	311	Species:	Drosophila melanogaster
Sequence 2:	XP_011533135.1	Gene:	ZNF140 / 7699	HGNCID:	12925	Length:	458	Species:	Homo sapiens

Alignment Length:	87	Identity:	37/87 - (42%)
Similarity:	53/87 - (60%)	Gaps:	4/87 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly   193 GERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPY 257
            ||:.|.||  .|.|.:::.::|..|.|.|:|:|.|:|.  .|...||...||.||:.:|:|.|||
Human   242 GEKPYECT--ECGKAFSRASNLTRHQRIHIGKKQYICR--KCGKAFSSGSELIRHQITHTGEKPY 302

  Fly   258 KCDYCSKCFARSDHLTKHRKVH 279
            :|..|.|.|.|..|||:|:.:|
Human   303 ECIECGKAFRRFSHLTRHQSIH 324

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Klf15	NP_572185.1	zf-C2H2_8	199..278	CDD:292531	33/78 (42%)
		C2H2 Zn finger	203..221	CDD:275368	5/17 (29%)
		C2H2 Zn finger	229..251	CDD:275368	8/21 (38%)
		zf-H2C2_2	243..268	CDD:290200	13/24 (54%)
		C2H2 Zn finger	259..279	CDD:275368	9/19 (47%)
ZNF140	XP_011533135.1	KRAB	6..66	CDD:214630
		KRAB	6..45	CDD:279668
		COG5048	160..>453	CDD:227381	37/87 (43%)
		C2H2 Zn finger	164..184	CDD:275368
		zf-H2C2_2	176..201	CDD:290200
		C2H2 Zn finger	192..212	CDD:275368
		zf-H2C2_2	204..229	CDD:290200
		C2H2 Zn finger	220..240	CDD:275368
		zf-H2C2_2	233..257	CDD:290200	7/16 (44%)
		C2H2 Zn finger	248..268	CDD:275368	7/21 (33%)
		zf-H2C2_2	260..285	CDD:290200	10/26 (38%)
		C2H2 Zn finger	276..296	CDD:275368	8/21 (38%)
		zf-H2C2_2	288..313	CDD:290200	13/24 (54%)
		C2H2 Zn finger	304..324	CDD:275368	9/19 (47%)
		C2H2 Zn finger	332..352	CDD:275368
		C2H2 Zn finger	360..380	CDD:275368
		zf-H2C2_2	372..397	CDD:290200
		C2H2 Zn finger	388..408	CDD:275368
		zf-H2C2_2	400..424	CDD:290200
		C2H2 Zn finger	416..436	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	0	0.000