DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and Klf17

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_083692.2 Gene:Klf17 / 75753 MGIID:2181068 Length:341 Species:Mus musculus


Alignment Length:226 Identity:70/226 - (30%)
Similarity:104/226 - (46%) Gaps:63/226 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 TNGNIQVGL----------PHVEDPSLFID--FNDLTVCPPDLSDWEQRLLDNYVEIPDLVDFLP 126
            |.|:::.|:          .|...|  |:|  .:.:..|.|::                    ||
Mouse   156 TTGSLKHGILLVPGMASAGTHAVAP--FMDQMLHSINPCNPEM--------------------LP 198

  Fly   127 ER----TPLCTDNCADFLEESNSNLRLSGPPHSEIFVPDRSSSSPGSSDSASPAEAV----APPS 183
            .|    .||  |:....:.|||:        ..|.||.:..:.:|..::|.|.:...    :|.|
Mouse   199 ARFQQLLPL--DSQDSLVTESNT--------QEEPFVREPPTPAPEGAESPSTSRGATRRQSPVS 253

  Fly   184 ALQMSENAAGERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHK 248
                       |.|:||:.:|.|.|.|.:||.:|.|:|.|.||:.|.|..|.|:|.|||||.|||
Mouse   254 -----------RPYVCTYNSCGKSYTKRSHLVSHQRKHTGVKPFACDWNGCTWKFFRSDELGRHK 307

  Fly   249 RSHSGVKPYKCDYCSKCFARSDHLTKHRKVH 279
            |.|:..:|:|||.|.:.|.|||||.:|::.|
Mouse   308 RIHTRYRPHKCDECDREFMRSDHLRQHKRTH 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 41/78 (53%)
C2H2 Zn finger 203..221 CDD:275368 8/17 (47%)
C2H2 Zn finger 229..251 CDD:275368 14/21 (67%)
zf-H2C2_2 243..268 CDD:290200 13/24 (54%)
C2H2 Zn finger 259..279 CDD:275368 10/19 (53%)
Klf17NP_083692.2 COG5048 <22..317 CDD:227381 58/203 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..252 9/45 (20%)
zf-C2H2 256..280 CDD:278523 11/23 (48%)
C2H2 Zn finger 261..280 CDD:275368 8/18 (44%)
C2H2 Zn finger 288..310 CDD:275368 14/21 (67%)
zf-H2C2_2 302..325 CDD:290200 12/22 (55%)
zf-C2H2 316..338 CDD:278523 11/21 (52%)
C2H2 Zn finger 318..338 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841542
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.