| Sequence 1: | NP_572185.1 | Gene: | Klf15 / 31410 | FlyBaseID: | FBgn0025679 | Length: | 311 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_083189.2 | Gene: | Zfp819 / 74400 | MGIID: | 1921650 | Length: | 607 | Species: | Mus musculus |
| Alignment Length: | 355 | Identity: | 89/355 - (25%) |
|---|---|---|---|
| Similarity: | 128/355 - (36%) | Gaps: | 124/355 - (34%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 6 TGGFQQLYSDLEEEPLAGGDALLNIVSVGEFDSTYVDTSFSGGNYNQLEFEESDYYGIITLDSNN 70
Fly 71 NTNTNGNIQVGL--------------------PHV-----------EDPSLFID----FND---L 97
Fly 98 TVCPPDLSDWEQRLLDNYVEIPDLVDFLPER--------------------------TPLC---T 133
Fly 134 DN----------CA-DFLEESNSNLRLSGPPHSEIFVPDRSSSSPGSSDSASPA--EAVAPPSAL 185
Fly 186 QMSENA-AGERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKR 249
Fly 250 SHSGVKPYKCDYCSKCFARSDHLTKHRKVH 279 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Klf15 | NP_572185.1 | zf-C2H2_8 | 199..278 | CDD:292531 | 35/78 (45%) |
| C2H2 Zn finger | 203..221 | CDD:275368 | 8/17 (47%) | ||
| C2H2 Zn finger | 229..251 | CDD:275368 | 9/21 (43%) | ||
| zf-H2C2_2 | 243..268 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 259..279 | CDD:275368 | 7/19 (37%) | ||
| Zfp819 | NP_083189.2 | KRAB | 27..81 | CDD:214630 | |
| COG5048 | <293..531 | CDD:227381 | 53/160 (33%) | ||
| C2H2 Zn finger | 302..322 | CDD:275368 | 7/28 (25%) | ||
| C2H2 Zn finger | 330..350 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 358..378 | CDD:275368 | 9/21 (43%) | ||
| C2H2 Zn finger | 386..406 | CDD:275368 | 9/21 (43%) | ||
| C2H2 Zn finger | 414..434 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 442..462 | CDD:275368 | |||
| C2H2 Zn finger | 470..490 | CDD:275368 | |||
| C2H2 Zn finger | 498..518 | CDD:275368 | |||
| C2H2 Zn finger | 526..546 | CDD:275368 | |||
| zf-H2C2_2 | 539..563 | CDD:372612 | |||
| C2H2 Zn finger | 554..574 | CDD:275368 | |||
| C2H2 Zn finger | 582..602 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||