DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and KLF9

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001197.1 Gene:KLF9 / 687 HGNCID:1123 Length:244 Species:Homo sapiens


Alignment Length:166 Identity:70/166 - (42%)
Similarity:94/166 - (56%) Gaps:15/166 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 DLVDFLPERTPLCTDNCADFLEESNSNLRLSGPPHSEIFVPDRSSSSPGSS--DSASPAEAVAPP 182
            ||..:.|.:||   ..|:|.||..:.::      .|:..|...|.|||..|  :...|..|.:|.
Human    69 DLNKYRPIQTP---SVCSDSLESPDEDM------GSDSDVTTESGSSPSHSPEERQDPGSAPSPL 124

  Fly   183 SALQMSENAAG----ERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDE 243
            |.|.....|.|    |:.:.|.:..|.|:|.|.:|||||.|.|.||:|:.|:||||:.:||||||
Human   125 SLLHPGVAAKGKHASEKRHKCPYSGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDCLKKFSRSDE 189

  Fly   244 LARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVH 279
            |.||.|:|:|.|.::|..|.|.|.||||||||.:.|
Human   190 LTRHYRTHTGEKQFRCPLCEKRFMRSDHLTKHARRH 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 45/78 (58%)
C2H2 Zn finger 203..221 CDD:275368 10/17 (59%)
C2H2 Zn finger 229..251 CDD:275368 15/21 (71%)
zf-H2C2_2 243..268 CDD:290200 12/24 (50%)
C2H2 Zn finger 259..279 CDD:275368 12/19 (63%)
KLF9NP_001197.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..142 19/67 (28%)
COG5048 <94..234 CDD:227381 61/132 (46%)
C2H2 Zn finger 145..167 CDD:275368 11/21 (52%)
C2H2 Zn finger 175..197 CDD:275368 15/21 (71%)
C2H2 Zn finger 205..225 CDD:275368 12/19 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 130 1.000 Inparanoid score I4659
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.