DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and ZNF674

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001034980.1 Gene:ZNF674 / 641339 HGNCID:17625 Length:581 Species:Homo sapiens


Alignment Length:314 Identity:77/314 - (24%)
Similarity:125/314 - (39%) Gaps:91/314 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FDSTYVDTSFSGGNYNQLEFEESDYYGIITLDSNNNTNTNGNIQVGLPHV------EDPSLFID- 93
            |...:||  |:...:.||:..:.:.|..:.|::.::..:.|:: ||.|.|      .|.|...| 
Human    10 FKDVFVD--FTLEEWQQLDSAQKNLYRDVMLENYSHLVSVGHL-VGKPDVIFRLGPGDESWMADG 71

  Fly    94 FNDLTVCP----PDLSDWE-QRLLDNYVEIPDL-------------------------------V 122
            ...:..|.    |::  || ...:|:|.|..|.                               .
Human    72 GTPVRTCAGEDRPEV--WEVDEQIDHYKESQDKFLWQAAFIGKETLKDESGQECKICRKIIYLNT 134

  Fly   123 DF--LPERTP------LCTDNCADFLEESNSNLRL------------------SGPPHSEIFVPD 161
            ||  :.:|.|      .|:.:..:||.::.|.:|.                  ...|....|.|:
Human   135 DFVSVKQRLPKYYSWERCSKHHLNFLGQNRSYVRKKDDGCKAYWKVCLHYNLHKAQPAERFFDPN 199

  Fly   162 RSSSSPGSSDSASPAEAVAPPSALQMSENA-AGERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEK 225
            :.            .:|:....||:.|:.: .||:.|.||  .|.|::.:.|:|..|.|.|.|||
Human   200 QR------------GKALHQKQALRKSQRSQTGEKLYKCT--ECGKVFIQKANLVVHQRTHTGEK 250

  Fly   226 PYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVH 279
            ||.|.  :|...||:...|..|:|:|:|.|||:|..|.|.|.:...|.||::.|
Human   251 PYECC--ECAKAFSQKSTLIAHQRTHTGEKPYECSECGKTFIQKSTLIKHQRTH 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 33/78 (42%)
C2H2 Zn finger 203..221 CDD:275368 6/17 (35%)
C2H2 Zn finger 229..251 CDD:275368 7/21 (33%)
zf-H2C2_2 243..268 CDD:290200 12/24 (50%)
C2H2 Zn finger 259..279 CDD:275368 7/19 (37%)
ZNF674NP_001034980.1 KRAB 8..68 CDD:214630 15/60 (25%)
KRAB 8..47 CDD:279668 8/38 (21%)
COG5048 190..580 CDD:227381 44/129 (34%)
C2H2 Zn finger 202..218 CDD:275368 4/15 (27%)
zf-C2H2 224..246 CDD:278523 9/23 (39%)
C2H2 Zn finger 226..246 CDD:275368 8/21 (38%)
zf-H2C2_2 238..263 CDD:290200 12/26 (46%)
C2H2 Zn finger 254..274 CDD:275368 7/21 (33%)
zf-C2H2 280..302 CDD:278523 8/21 (38%)
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
zf-H2C2_2 295..319 CDD:290200 4/8 (50%)
C2H2 Zn finger 310..330 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..377
C2H2 Zn finger 387..407 CDD:275368
zf-H2C2_2 399..423 CDD:290200
C2H2 Zn finger 415..435 CDD:275368
zf-H2C2_2 427..450 CDD:290200
C2H2 Zn finger 443..463 CDD:275368
zf-H2C2_2 456..479 CDD:290200
C2H2 Zn finger 471..491 CDD:275368
zf-H2C2_2 484..508 CDD:290200
C2H2 Zn finger 499..519 CDD:275368
zf-H2C2_2 512..535 CDD:290200
C2H2 Zn finger 527..547 CDD:275368
zf-H2C2_2 540..563 CDD:290200
C2H2 Zn finger 555..575 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.