DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Klf15 and ZNF695

DIOPT Version :9

Sequence 1:	NP_572185.1	Gene:	Klf15 / 31410	FlyBaseID:	FBgn0025679	Length:	311	Species:	Drosophila melanogaster
Sequence 2:	NP_065127.5	Gene:	ZNF695 / 57116	HGNCID:	30954	Length:	515	Species:	Homo sapiens

Alignment Length:	89	Identity:	38/89 - (42%)
Similarity:	51/89 - (57%)	Gaps:	4/89 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly   193 GERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPY 257
            |::.|.|.  .|.|.:...::|..|.|.|.|||||.|.  :|...|:....|..|||.|:|.|||
Human   404 GQKPYKCE--ECGKAFTWFSYLTQHKRIHTGEKPYKCD--ECGKAFNWFSYLTNHKRIHTGEKPY 464

  Fly   258 KCDYCSKCFARSDHLTKHRKVHER 281
            ||:.|.|.|.:|.||:||:.:|.|
Human   465 KCEECGKAFGQSSHLSKHKTIHTR 488

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Klf15	NP_572185.1	zf-C2H2_8	199..278	CDD:292531	34/78 (44%)
		C2H2 Zn finger	203..221	CDD:275368	5/17 (29%)
		C2H2 Zn finger	229..251	CDD:275368	7/21 (33%)
		zf-H2C2_2	243..268	CDD:290200	14/24 (58%)
		C2H2 Zn finger	259..279	CDD:275368	9/19 (47%)
ZNF695	NP_065127.5	KRAB	4..76	CDD:214630
		COG5048	148..515	CDD:227381	38/89 (43%)
		C2H2 Zn finger	158..178	CDD:275368
		C2H2 Zn finger	186..206	CDD:275368
		C2H2 Zn finger	214..234	CDD:275368
		C2H2 Zn finger	242..262	CDD:275368
		C2H2 Zn finger	270..290	CDD:275368
		C2H2 Zn finger	298..318	CDD:275368
		C2H2 Zn finger	326..346	CDD:275368
		C2H2 Zn finger	354..374	CDD:275368
		C2H2 Zn finger	382..402	CDD:275368
		C2H2 Zn finger	410..430	CDD:275368	6/21 (29%)
		C2H2 Zn finger	438..458	CDD:275368	7/21 (33%)
		C2H2 Zn finger	466..486	CDD:275368	9/19 (47%)
		C2H2 Zn finger	494..514	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	0	0.000