DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Klf15 and zgc:173720

DIOPT Version :9

Sequence 1:	NP_572185.1	Gene:	Klf15 / 31410	FlyBaseID:	FBgn0025679	Length:	311	Species:	Drosophila melanogaster
Sequence 2:	NP_001107078.1	Gene:	zgc:173720 / 566529	ZFINID:	ZDB-GENE-080218-21	Length:	320	Species:	Danio rerio

Alignment Length:	87	Identity:	34/87 - (39%)
Similarity:	51/87 - (58%)	Gaps:	4/87 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly   193 GERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPY 257
            ||:.:.||  .|.|.:::.:.|..|:..|.||||:.|  |.|...||:|....:|.|.|:|.||:
Zfish   173 GEKPFTCT--QCGKSFSQLSFLNHHMMIHTGEKPFTC--PQCGKSFSKSSNFNQHMRIHTGEKPF 233

  Fly   258 KCDYCSKCFARSDHLTKHRKVH 279
            .|..|.|.:::|.||.||.::|
Zfish   234 TCTQCGKSYSQSSHLNKHIRIH 255

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Klf15	NP_572185.1	zf-C2H2_8	199..278	CDD:292531	31/78 (40%)
		C2H2 Zn finger	203..221	CDD:275368	4/17 (24%)
		C2H2 Zn finger	229..251	CDD:275368	8/21 (38%)
		zf-H2C2_2	243..268	CDD:290200	9/24 (38%)
		C2H2 Zn finger	259..279	CDD:275368	8/19 (42%)
zgc:173720	NP_001107078.1	C2H2 Zn finger	67..87	CDD:275368
		zf-H2C2_2	79..104	CDD:290200
		C2H2 Zn finger	95..115	CDD:275368
		zf-C2H2	121..143	CDD:278523
		C2H2 Zn finger	123..143	CDD:275368
		zf-H2C2_2	135..160	CDD:290200
		COG5048	<147..307	CDD:227381	34/87 (39%)
		C2H2 Zn finger	151..171	CDD:275368
		zf-H2C2_2	163..188	CDD:290200	6/16 (38%)
		C2H2 Zn finger	179..199	CDD:275368	6/21 (29%)
		zf-H2C2_2	192..215	CDD:290200	10/24 (42%)
		C2H2 Zn finger	207..227	CDD:275368	8/21 (38%)
		zf-H2C2_2	219..244	CDD:290200	9/24 (38%)
		C2H2 Zn finger	235..255	CDD:275368	8/19 (42%)
		zf-H2C2_2	247..272	CDD:290200	5/9 (56%)
		C2H2 Zn finger	263..283	CDD:275368
		zf-H2C2_2	275..300	CDD:290200
		C2H2 Zn finger	291..311	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	0	0.000