DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and klf11a

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_021324131.1 Gene:klf11a / 560787 ZFINID:ZDB-GENE-030131-3568 Length:479 Species:Danio rerio


Alignment Length:260 Identity:77/260 - (29%)
Similarity:114/260 - (43%) Gaps:66/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SNNNTNTNGNIQV------------GLPHVEDPSLFIDFNDLTV------CPPDLS-----DWEQ 109
            :.:||:..|.:|:            ..|..:...:.|..:..|:      .||.|.     :.:.
Zfish   200 TESNTSLKGEVQICSSPCDSAEPERTAPSPDSTGIAIPTSQSTIPQSPMSSPPVLCQVFPVNGQT 264

  Fly   110 RLLDNYVEIPDLVD------FLPERTPLCTDNCADFLEESNSNLRLSGPPHSE---IFVPDRSSS 165
            .::..:|:.|..:.      .||...||                 |.|.|.::   :||..:|..
Zfish   265 GIISAFVQTPVQMQTSGSKPILPHSQPL-----------------LVGSPVAQGTVMFVVPQSQV 312

  Fly   166 SPGSSDSAS-------------PAEAVAP---PSALQMSENAAGERGYLCTFGNCEKIYAKPAHL 214
            |..|:...|             ||....|   .|.:..|: .:..|.|:|.|..|:|.|.|.:||
Zfish   313 SQSSTCQQSVVTLGNTKLLPLAPAPVYVPSGQSSGVTQSD-FSRRRNYVCNFQGCKKTYFKSSHL 376

  Fly   215 KAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVH 279
            |||||.|.||||:.|.|..|..:|:|||||:||:|:|:|.|.:.|..|.:.|.||||||||.:.|
Zfish   377 KAHLRTHTGEKPFSCHWEGCDKKFARSDELSRHRRTHTGEKKFVCPVCERRFMRSDHLTKHARRH 441

  Fly   280  279
            Zfish   442  441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 44/78 (56%)
C2H2 Zn finger 203..221 CDD:275368 11/17 (65%)
C2H2 Zn finger 229..251 CDD:275368 12/21 (57%)
zf-H2C2_2 243..268 CDD:290200 11/24 (46%)
C2H2 Zn finger 259..279 CDD:275368 11/19 (58%)
klf11aXP_021324131.1 MotB_plug <203..345 CDD:330912 28/158 (18%)
C2H2 Zn finger 361..383 CDD:275368 13/21 (62%)
zf-H2C2_2 375..402 CDD:316026 16/26 (62%)
C2H2 Zn finger 391..413 CDD:275368 12/21 (57%)
zf-H2C2_2 405..428 CDD:316026 10/22 (45%)
zf-C2H2 419..441 CDD:306579 11/21 (52%)
C2H2 Zn finger 421..441 CDD:275368 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.