DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and klf5b

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_688525.5 Gene:klf5b / 560043 ZFINID:ZDB-GENE-080424-4 Length:344 Species:Danio rerio


Alignment Length:323 Identity:100/323 - (30%)
Similarity:134/323 - (41%) Gaps:100/323 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DSTYVDTSF-----SGGNYNQLE-----FEESDYYGII--TLDSNNNTN-------TNGNIQVGL 82
            |.||:.|..     |.|...:.|     |..|..:|.:  |:.....||       |..|:.:  
Zfish    42 DVTYLRTGMCRTVRSVGPQIKTEPIHSSFNYSSCHGTVAPTMTHQEYTNLYTPAPETGSNVYI-- 104

  Fly    83 PHVEDPSLFIDFNDL-------------------------TVCPPDLSDWEQ------------- 109
            .| |.||  |:|.|:                         ..||| :|.:..             
Zfish   105 KH-ETPS--IEFQDVPLFQLLNSDLEPNVPGGHSCTDSHNATCPP-MSTYNSIHPASSHGTERSI 165

  Fly   110 -RLLDNYVEIPDLVDFLPERTPLCTDNCADFLEESNSNLRLSGPPHSEIFVPDR-----SSSSPG 168
             .:..|...:|......|::.       |.:|..|        ||:||...|||     .:.||.
Zfish   166 CNMASNGYSLPAQFGQHPQKR-------AAYLPPS--------PPNSEPGSPDRRKELIQNLSPP 215

  Fly   169 SSDSASPAEAVA-----PPSALQMSENAA-----------GERGYLCTFGNCEKIYAKPAHLKAH 217
            .|.:||.|..:|     |..::|..:..|           ..|.:.|....|:|:|.|.:|||||
Zfish   216 PSYAASMASKMACLTPGPALSVQTQQVPAQYNRRSNPDLDKRRIHHCDVPGCKKVYTKSSHLKAH 280

  Fly   218 LRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVHE 280
            ||.|.|||||.|||..|.|||:|||||.||.|.|:|.||::|..||:||:|||||..|.|.|:
Zfish   281 LRTHTGEKPYKCSWEGCDWRFARSDELTRHFRKHTGAKPFQCSVCSRCFSRSDHLALHMKRHQ 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 48/78 (62%)
C2H2 Zn finger 203..221 CDD:275368 11/17 (65%)
C2H2 Zn finger 229..251 CDD:275368 15/21 (71%)
zf-H2C2_2 243..268 CDD:290200 14/24 (58%)
C2H2 Zn finger 259..279 CDD:275368 12/19 (63%)
klf5bXP_688525.5 COG5048 236..>323 CDD:227381 40/86 (47%)
C2H2 Zn finger 265..284 CDD:275368 11/18 (61%)
C2H2 Zn finger 292..314 CDD:275368 15/21 (71%)
zf-H2C2_2 306..331 CDD:290200 14/24 (58%)
C2H2 Zn finger 322..342 CDD:275368 12/19 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4706
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.