| Sequence 1: | NP_572185.1 | Gene: | Klf15 / 31410 | FlyBaseID: | FBgn0025679 | Length: | 311 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_684045.1 | Gene: | si:ch211-117k10.3 / 556200 | ZFINID: | ZDB-GENE-141212-273 | Length: | 371 | Species: | Danio rerio |
| Alignment Length: | 388 | Identity: | 107/388 - (27%) |
|---|---|---|---|
| Similarity: | 141/388 - (36%) | Gaps: | 149/388 - (38%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 30 IVSVGEFDSTYVDTSFSGGNYNQLEFEESDYYGIITLDSNNNTNTNGNIQVGLPHVEDPSLFIDF 94
Fly 95 NDLTVCPPDLSDWE---QRLLDN----YVEIPDLVDFLPERTPLCTDNCADFLEESNSNLRLSGP 152
Fly 153 PHSEIFVPDRSS---------SSPGSSDSASPAEA------------------VAPPSALQMS-- 188
Fly 189 ---------ENAAGERGYL---------------------------------------------- 198
Fly 199 -----------------------------------CTFGNCEKIYAKPAHLKAHLRRHLGEKPYV 228
Fly 229 CSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVHERRLLAASRAGR 291 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Klf15 | NP_572185.1 | zf-C2H2_8 | 199..278 | CDD:292531 | 57/78 (73%) |
| C2H2 Zn finger | 203..221 | CDD:275368 | 11/17 (65%) | ||
| C2H2 Zn finger | 229..251 | CDD:275368 | 18/21 (86%) | ||
| zf-H2C2_2 | 243..268 | CDD:290200 | 17/24 (71%) | ||
| C2H2 Zn finger | 259..279 | CDD:275368 | 13/19 (68%) | ||
| si:ch211-117k10.3 | XP_684045.1 | zf-C2H2 | 276..300 | CDD:278523 | 12/23 (52%) |
| zf-C2H2_8 | 278..357 | CDD:292531 | 57/78 (73%) | ||
| C2H2 Zn finger | 278..300 | CDD:275368 | 12/21 (57%) | ||
| zf-H2C2_2 | 292..319 | CDD:290200 | 22/26 (85%) | ||
| C2H2 Zn finger | 308..330 | CDD:275368 | 18/21 (86%) | ||
| zf-H2C2_2 | 322..347 | CDD:290200 | 17/24 (71%) | ||
| C2H2 Zn finger | 338..358 | CDD:275368 | 13/19 (68%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170596761 | |
| Domainoid | 1 | 1.000 | 54 | 1.000 | Domainoid score | I11287 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 1 | 1.000 | - | - | otm26322 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | LDO | PTHR23235 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2698 |
| SonicParanoid | 1 | 1.000 | - | - | X4659 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 7 | 6.970 | |||||